• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> P Glycoprotein Antibody

P Glycoprotein Antibody (RQ4527)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4527 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Immunofluorescent staining of FFPE human U-2 OS cells with P Glycoprotein antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
›
Immunofluorescent staining of FFPE human U-2 OS cells with P Glycoprotein antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human U-2 OS cells with P Glycoprotein antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= P Glycoprotein antibody.
Western blot testing of human 1) THP-1 and 2) A375 cell lysate with P Glycoprotein antibody at 0.5ug/ml. Expected molecular weight: 141-180 kDa depending on glycosylation level.
Availability 1-3 business days
Species Reactivity Human
Format Purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Protein A affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P08183
Localization Cell membrane
Applications Western blot : 0.5-1ug/ml
Immunofluorescence (FFPE) : 2-4ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This P Glycoprotein antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P-GP is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier.

Application Notes

Optimal dilution of the P Glycoprotein antibody should be determined by the researcher.

Immunogen

Amino acids QAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPY were used as the immunogen for the P Glycoprotein antibody antibody.

Storage

After reconstitution, the P Glycoprotein antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all P Glycoprotein antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.