- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
P Glycoprotein Antibody (R30136)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
R30136 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 429 |
| Availability | 1-3 business days |
| Species Reactivity | Human, Mouse, Rat |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide/thimerosal |
| Gene ID | 5243 |
| Applications | IHC (FFPE) : 0.5-1ug/ml IHC (Frozen) : 0.5-1ug/ml |
| Limitations | This P Glycoprotein antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
P Glycoprotein, also called MDR1, P-GP, and PGY1, is a protein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. It is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P Glycoprotein is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood–brain barrier.
The stated application concentrations are suggested starting amounts. Titration of the P Glycoprotein antibody may be required due to differences in protocols and secondary/substrate sensitivity.
Amino acids IYFKLVTMQTAGNEVELENAADESKSEIDA were used as the immunogen for this P Glycoprotein antibody.
After reconstitution, the P Glycoprotein antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz
