- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
OTX2 Antibody recognizes orthodenticle homeobox 2 (OTX2), a homeobox-containing transcription factor that plays an essential role in embryonic development of the central nervous system, eyes, and sensory organs. Orthodenticle homeobox 2 regulates gene expression by binding specific DNA sequences that control cell fate determination, tissue patterning, and cellular differentiation. During vertebrate development, OTX2 is indispensable for formation of the forebrain and midbrain and is also required for normal development of the retina, retinal pigment epithelium, pineal gland, inner ear, and pituitary gland. An Orthodenticle Homeobox 2 Antibody is widely used to investigate these developmental pathways and the molecular mechanisms governing tissue specification.
In adult tissues, orthodenticle homeobox 2 continues to perform specialized functions within the nervous system and visual pathway. It is required for maintenance of photoreceptors and retinal pigment epithelial cells, contributes to retinal homeostasis, and supports the survival and maturation of specific neuronal populations. OTX2 also influences cortical plasticity through intercellular transfer to parvalbumin-positive interneurons, making it an important regulator of neural circuit maturation. An Orthodenticle Homeobox 2 Antibody is therefore valuable for studies of neurodevelopment, retinal biology, and stem cell differentiation.
Aberrant expression of orthodenticle homeobox 2 has been linked to numerous human diseases, including congenital eye malformations, developmental disorders, and several malignancies. Elevated OTX2 expression has been reported in medulloblastoma, retinoblastoma, pineoblastoma, and other cancers, where it contributes to tumor cell proliferation, lineage specification, and maintenance of the malignant phenotype. Researchers frequently examine orthodenticle homeobox 2 alongside other developmental transcription factors to better understand the molecular mechanisms governing embryogenesis, tissue differentiation, and tumor biology.
An OTX2 Antibody is a valuable research tool for investigating orthodenticle homeobox 2 expression, transcriptional regulation, neural development, retinal biology, stem cell differentiation, and cancer biology.
Learn more about related developmental regulators by exploring our Transcription Factor Antibodies page.
The stated application concentrations are suggested starting amounts. Titration of the OTX2 Antibody / Orthodenticle Homeobox 2 Antibody may be required due to differences in protocols and secondary/substrate sensitivity.
An amino acid sequence from the C-terminus of human Orthodenticle homeobox 2 (DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL) was used as the immunogen for this OTX2 antibody (100% mouse homology).
After reconstitution, the OTX2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
OTX2 antibody, Orthodenticle Homeobox 2 antibody, Orthodenticle Homolog 2 antibody, Homeobox Protein OTX2 antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.