• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Otoferlin Antibody / OTOF

Otoferlin Antibody / OTOF (R32323)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32323 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
IHC testing of FFPE mouse brain tissue with Otoferlin antibody. HIER: Boil the paraffin sections in pH 8 EDTA buffer for 20 minutes and allow to cool prior to staining.
›
IHC testing of FFPE mouse brain tissue with Otoferlin antibody. HIER: Boil the paraffin sections in pH 8 EDTA buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat brain tissue with Otoferlin antibody. HIER: Boil the paraffin sections in pH 8 EDTA buffer for 20 minutes and allow to cool prior to staining.
Western blot testing of 1) rat brain and 2) mouse brain tissue lysate with Otoferlin antibody. Predicted molecular weight: 226-227 kDa (long form, two isoforms), 140-149 kDa (short form, three isoforms).
Availability 1-3 business days
Species Reactivity Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt Q9HC10
Localization Cytoplasmic, cell membrane
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Limitations This Otoferlin antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Otoferlin is a protein that in humans is encoded by the OTOF gene. Mutations in this gene are a cause of neurosensory nonsyndromic recessive deafness, DFNB9. The short form of the encoded protein has three C2 domains, a single carboxy-terminal transmembrane domain found also in the C. elegans spermatogenesis factor FER-1 and human dysferlin, while the long form has six C2 domains. The homology suggests that this protein may be involved in vesicle membrane fusion. Several transcript variants encoding multipleisoforms have been found for this gene.

Application Notes

Optimal dilution of the Otoferlin antibody should be determined by the researcher.

Immunogen

Amino acids QIWDADHFSADDFLGAIELDLNRFPRGAKTAKQ of human OTOF were used as the immunogen for the Otoferlin antibody.

Storage

After reconstitution, the Otoferlin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Otoferlin antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.