• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> NTCP Antibody / SLC10A1

NTCP Antibody / SLC10A1 (R31795)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R31795 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat liver and 2) mouse liver lysate with SLC10A1 antibody. Expected molecular weight: 38~45 kDa.
›
Western blot testing of 1) rat liver and 2) mouse liver lysate with SLC10A1 antibody. Expected molecular weight: 38~45 kDa.
IHC testing of FFPE human liver cancer tissue with NTCP antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse liver with NTCP antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat liver with NTCP antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of frozen mouse liver tissue with NTCP antibody.
Flow cytometry testing of Buffalo rat liver (BRL 3A) cells with NTCP antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=NTCP antibody.
Immunofluorescent staining of FFPE mouse liver with NTCP antibody (green) and DAPI nuclear counterstain (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Immunofluorescent staining of FFPE mouse liver with NTCP antibody (red) and DAPI nuclear counterstain (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Western blot testing of 1) rat liver and 2) rat kidney lysate with SLC10A1 antibody. Expected molecular weight: 38~45 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt O08705
Localization Membrane
Applications Western blot : 0.1-0.5ug/ml
Immunohistochemistry (FFPE) : 0.5-1ug/ml
Immunohistochemistry (Frozen) : 0.5-1ug/ml
Flow cytometry : 1-3ug/10^6 cells
Immunofluorescence (FFPE) : 1-2ug/ml
Limitations This NTCP antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P
    Reactivity : Human, Mouse, Rat
  • Applications : WB
    Reactivity : Rat
  • Applications : WB, IHC-P, IF, FACS, Direct ELISA
    Reactivity : Mouse, Rat
  • Applications : WB, Direct ELISA
    Reactivity : Human, Mouse, Rat, Monkey

Description

Na+-taurocholate cotransporting polypeptide (NTCP), also known as SLC10A1 (Solute carrier family 10, member 1), is the major bile acid uptake system in human hepatocytes. NTCP and the ileal transporter ASBT (apical sodium-dependent bile acid transporter) are two sodium-dependent transporters critical for the enterohepatic circulation of bile acids. The hASBT gene is known to be activated by the glucocorticoid receptor (GR). Ho RH et al. indicates functionally important polymorphisms in NTCP exist and that the like lihood of being carriers of such polymorphisms is dependent on ethnicity.

Application Notes

Optimal dilution of the NTCP antibody should be determined by the researcher.

Immunogen

Amino acids EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK of mouse SLC10A1/NTCP were used as the immunogen for the NTCP antibody.

Storage

After reconstitution, the NTCP antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all SLC10A1 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.