- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Neuron-specific enolase (NSE), also known as Gamma-enolase or ENO2, is a glycolytic enzyme predominantly expressed in neurons and neuroendocrine cells, where it serves as a well-established marker of neuronal differentiation and neuroendocrine lineage. NSE is localized to the cytoplasm and is widely used in fluorescence-based imaging to visualize neuronal and neuroendocrine cell populations with high spatial resolution. NSE Antibody for IF enables precise detection of ENO2 expression in fixed cells and tissue sections, where cytoplasmic fluorescence highlights cell bodies, processes, and structural organization within complex tissue environments.
NSE antibody, also referred to as ENO2 antibody or Gamma-enolase antibody in the literature, recognizes a cytoplasmic protein with highly enriched expression in neuronal and neuroendocrine cells. In immunofluorescence applications, NSE staining produces a robust and well-defined cytoplasmic fluorescence signal that clearly delineates neuronal morphology, including soma and extending processes, as well as neuroendocrine cell populations embedded within heterogeneous tissues. This distinct signal-to-background profile allows accurate identification of ENO2-positive cells and facilitates detailed visualization of cellular architecture in situ.
In cultured cell systems and tissue sections, NSE immunofluorescence reveals characteristic cytoplasmic distribution patterns that correlate with neuronal identity and neuroendocrine differentiation. The antibody is well suited for co-localization studies, where NSE can be combined with nuclear markers, cytoskeletal proteins, or lineage-specific markers to define cell populations and assess differentiation status. This capability enables multi-parameter fluorescence imaging approaches to investigate cellular composition, lineage relationships, and spatial organization within tissues.
In cancer research, NSE immunofluorescence is particularly useful for identifying tumor cells with neuroendocrine differentiation, where strong cytoplasmic fluorescence distinguishes ENO2-positive tumor cells from surrounding stromal or non-neoplastic cells. This supports visualization of tumor heterogeneity and enables mapping of neuroendocrine features within tumor microenvironments using fluorescence microscopy. The ability to resolve these patterns at the single-cell level provides valuable insight into tumor cell identity and distribution.
This antibody targets Neuron Specific Enolase in research applications requiring sensitive and high-resolution immunofluorescent detection of neuronal and neuroendocrine markers, making it well suited for studies of cellular localization, co-localization analysis, neuronal morphology, and fluorescence-based imaging of tissue and cell models.
This antibody is part of the Gamma-enolase antibody collection, where additional ENO2 antibodies for immunohistochemistry can be explored.
Optimal dilution of the NSE Antibody for IF / ENO2 Immunofluorescence Antibody should be determined by the researcher.
Amino acids LKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENK were used as the immunogen for the NSE antibody.
After reconstitution, the NSE antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
NSE IF antibody, ENO2 antibody, Gamma-enolase antibody, neuron-specific enolase immunofluorescence antibody, ENO2 IF antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.