• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> NQO1 Antibody

NQO1 Antibody (R31977)

  Catalog No Formulation Size Price (USD)  
Image R31977 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of 1) rat liver, 2) rat lung, 3) human HeLa, 4) A549, 5) MM231, 6) SW620 and 7) 22RV1 with NQO1 antibody. Predicted/observed molecular weight ~30 kDa.
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P15559
Applications Western Blot : 0.1-0.5ug/ml
Limitations This NQO1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IF, IHC-P
    Reactivity : Human, Mouse, Rat
    Rab Mono Image
  • Applications : WB
    Reactivity : Human, Mouse, Rat
  • Applications : WB, FACS, IF, ELISA
    Reactivity : Human
  • Applications : WB, IF/ICC, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Dog, Pig, Cow
  • Applications : WB, IHC-P, IF/ICC, ELISA (peptide)
    Reactivity : Human, Rat, Pig
  • Applications : WB, IF, IHC-P, FACS
    Reactivity : Human

Description

This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. And this FAD-binding protein forms homodimers and reduces quinones to hydroquinones. In addition, this protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Application Notes

Optimal dilution of the NQO1 antibody should be determined by the researcher.

Immunogen

Amino acids EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK of human NQO1 were used as the immunogen for the NQO1 antibody.

Storage

After reconstitution, the NQO1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.