• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> NM23 Antibody / NME1

NM23 Antibody / NME1 (R31976)

  Catalog No Formulation Size Price (USD)  
Image R31976 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of 1) rat brain, 2) rat liver, 3) rat lung, 4) rat C6, 5) mouse brain, 6) mouse liver, 7) mouse lung and 8) mouse NIH 3T3 cell lysate with NM23 antibody. Expected molecular weight: 17/20 kDa (NM23-H1A/-H1B).
Western blot testing of human 1) HeLa, 2) A431, 3) HepG2, 4) K562, 5) MCF7, 6) A375 and 7) MOLT4 cell lysate with NM23 antibody. Expected molecular weight: 17/20 kDa (NM23-H1A/-H1B).
Flow cytometry testing of fixed and permeabilized human HEL cells with NM23 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=NM23 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P15531
Applications Western Blot : 0.5-1ug/ml
Flow Cytometry : 1-3ug/10^6 cells
Limitations This NM23 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

NME1, also called NM23, NM23-H1, NDPKA, GAAD or AWD, is an enzyme that in humans is encoded by the NME1 gene. The promoters of the mouse and human NME1 genes, like those of other NME genes, contain several binding sites for AP2, NF1, Sp1, LEF1, and response elements to glucocorticoid receptors. The NME1 gene is mapped on 17q21.33. Immunofluorescence microscopy demonstrated colocalization of NME1 in nuclei of B cells expressing EBNA3C. Expression of EBNA3C reversed the ability of NME1 to inhibit migration of BL and breast carcinoma cells. NM23H1 bound SET and was released from inhibition by GZMA cleavage of SET. After GZMA loading or cytotoxic T lymphocyte attack, SET and NM23H1 translocated to the nucleus and SET was degraded, allowing NM23H1 to nick chromosomal DNA. Using a Drosophila model system, Dammai et al. (2003) showed that the Drosophila NME1 homolog, awd, regulates trachea cell motility by modulating FGFR levels through a dynamin -mediated pathway.

Application Notes

Optimal dilution of the NM23 antibody should be determined by the researcher.

Immunogen

Amino acids KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR of human NM23A were used as the immunogen for the NM23 antibody.

Storage

After reconstitution, the NM23 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.