- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
NME1, also called NM23, NM23-H1, NDPKA, GAAD or AWD, is an enzyme that in humans is encoded by the NME1 gene. The promoters of the mouse and human NME1 genes, like those of other NME genes, contain several binding sites for AP2, NF1, Sp1, LEF1, and response elements to glucocorticoid receptors. The NME1 gene is mapped on 17q21.33. Immunofluorescence microscopy demonstrated colocalization of NME1 in nuclei of B cells expressing EBNA3C. Expression of EBNA3C reversed the ability of NME1 to inhibit migration of BL and breast carcinoma cells. NM23H1 bound SET and was released from inhibition by GZMA cleavage of SET. After GZMA loading or cytotoxic T lymphocyte attack, SET and NM23H1 translocated to the nucleus and SET was degraded, allowing NM23H1 to nick chromosomal DNA. Using a Drosophila model system, Dammai et al. (2003) showed that the Drosophila NME1 homolog, awd, regulates trachea cell motility by modulating FGFR levels through a dynamin -mediated pathway.
Optimal dilution of the NM23 antibody should be determined by the researcher.
Amino acids KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR of human NM23A were used as the immunogen for the NM23 antibody.
After reconstitution, the NM23 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.