• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> NKG2D Antibody

NKG2D Antibody (RQ4042)

  Catalog No Formulation Size Price (USD)  
Image RQ4042 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of 1) rat lymph, 2) rat spleen and 3) mouse thymus tissue lysate with NKG2D antibody at 0.5ug/ml. Predicted molecular weight ~25 kDa (unmodified), ~35 kDa (glycosylated).
Availability 1-3 business days
Species Reactivity Mouse, Rat
Predicted Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P26718
Applications Western Blot : 0.5-1ug/ml
Limitations This NKG2D antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat

Description

NKG2D is encoded by KLRK1 gene which is located in the NK-gene complex (NKC) situated on and chromosome 12 in humans. Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells. This gene encodes a member of the NKG2 family. The encoded transmembrane protein is characterized by a type II membrane orientation (has an extracellular C terminus) and the presence of a C-type lectin domain. It binds to a diverse family of ligands that include MHC class I chain-related A and B proteins and UL-16 binding proteins, where ligand-receptor interactions can result in the activation of NK and T cells. The surface expression of these ligands is important for the recognition of stressed cells by the immune system, and thus this protein and its ligands are therapeutic targets for the treatment of immune diseases and cancers. Read-through transcription exists between this gene and the upstream KLRC4 (killer cell lectin-like receptor subfamily C, member 4) family member in the same cluster.

Application Notes

Optimal dilution of the NKG2D antibody should be determined by the researcher.

Immunogen

Amino acids YQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYH from the human protein were used as the immunogen for the NKG2D antibody.

Storage

After reconstitution, the NKG2D antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.