• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> NFIA Antibody

NFIA Antibody (R32548)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32548 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) Jurkat and 2) COLO320 lysate with NFIA antibody at 0.5ug/ml. Predicted molecular weight ~56 kDa (unmodified), 60-70 kDa (phosphorylated).
›
Western blot testing of human 1) Jurkat and 2) COLO320 lysate with NFIA antibody at 0.5ug/ml. Predicted molecular weight ~56 kDa (unmodified), 60-70 kDa (phosphorylated).
Western blot testing of mouse 1) HEPA1-6 and 2) SP2/0 lysate with NFIA antibody at 0.5ug/ml. Predicted molecular weight ~56 kDa (unmodified), 60-70 kDa (phosphorylated).
IHC testing of FFPE human breast cancer tissue with NFIA antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE mouse liver with NFIA antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE rat liver with NFIA antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human K562 cells with NFIA antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=NFIA antibody.
Flow cytometry testing of human U-2 OS cells with NFIA antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=NFIA antibody.
Flow cytometry testing of human SiHa cells with NFIA antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=NFIA antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q12857
Localization Nuclear
Applications Western blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Flow cytometry : 1-3ug/10^6 cells
Limitations This NFIA antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimericDNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization.

Application Notes

Differences in protocols and secondary/substrate sensitivity may require the NFIA antibody to be titrated for optimal performance.

Immunogen

Amino acids 180-224 (AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS) from the human protein were used as the immunogen for the NFIA antibody.

Storage

After reconstitution, the NFIA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all NFIA antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.