NFIA Antibody / Nuclear factor 1 A-type (R32548)

Description

NFIA (Nuclear factor 1 A-type) is a transcription factor belonging to the nuclear factor I family, which binds specific DNA sequences to regulate gene expression during development and differentiation. NFIA functions as both a transcriptional activator and repressor and is involved in diverse biological processes, including glial cell development, organogenesis, and regulation of metabolic genes.

NFIA is highly expressed in the developing central nervous system, particularly in astrocyte and oligodendrocyte lineages, and it plays a pivotal role in the transition of neural stem cells toward glial fates. It also contributes to transcriptional regulation in other tissues, including kidney, lung, and liver, making it a widely studied marker in developmental biology and gene regulatory network research.

The NFIA antibody is a valuable tool for detecting endogenous NFIA in applications such as western blot, immunohistochemistry, and immunofluorescence. Researchers use the NFIA antibody from NSJ Bioreagents to assess protein expression, determine subcellular localization, and study NFIA’s role in lineage specification and transcriptional regulation. With high specificity and consistent performance, the NFIA antibody supports detailed investigations into neurodevelopment, transcription factor function, and cellular differentiation pathways.

Application Notes

Differences in protocols and secondary/substrate sensitivity may require the NFIA antibody to be titrated for optimal performance.

Immunogen

Amino acids 180-224 (AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS) from the human protein were used as the immunogen for the NFIA antibody.

Storage

After reconstitution, the NFIA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.