• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Neuroserpin Antibody

Neuroserpin Antibody (R32312)

  Catalog No Formulation Size Price (USD)  
Image R32312 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of 1) rat brain, 2) mouse brain, and 3) PANC lysate with Neuroserpin antibody. Expected/observed molecular weight ~46 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q99574
Applications Western Blot : 0.1-0.5ug/ml
Limitations This Neuroserpin antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P, FACS, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat, Pig, Cow
  • Applications : WB, FACS, IF, IHC-P
    Reactivity : Human

Description

Neuroserpin is a protein that in humans is encoded by the SERPINI1 gene. This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in the regulation of axonal growth and the development of synaptic plasticity. Mutations in this gene result in familial encephalopathy with neuroserpin inclusion bodies (FENIB), which is a dominantly inherited form of familial encephalopathy and epilepsy characterized by the accumulation of mutant neuroserpin polymers. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Application Notes

Optimal dilution of the Neuroserpin antibody should be determined by the researcher.

Immunogen

Amino acids KAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKA L of human Neuroserpin/SERPINI1 were used as the immunogen for the Neuroserpin antibody.

Storage

After reconstitution, the Neuroserpin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.