• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> Nectin-4 Antibody / PVRL4

Nectin-4 Antibody / PVRL4 (R32559)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32559 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) MCF7 and 2) MM453 lysate with Nectin-4 antibody at 0.5ug/ml. Expected molecular weight ~55 kDa (unmodified), ~66 kDa (glycosylated).
Western blot testing of human 1) MCF7 and 2) MM453 lysate with Nectin-4 antibody at 0.5ug/ml. Expected molecular weight ~55 kDa (unmodified), ~66 kDa (glycosylated).
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q96NY8
Applications Western blot : 0.5-1ug/ml
Limitations This Nectin-4 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

PVRL4, also known as Nectin-4, is expressed in human skin, hair follicles, and cultured keratinocytes, but not in fibroblasts. This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a single-pass type I membrane protein. The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE. The secreted form is found in both breast tumor cell lines and breast tumor patients. Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, an autosomal recessive disorder. Alternatively spliced transcript variants have been found but the full-length nature of the variant has not been determined.

Application Notes

Differences in protocols and secondary/substrate sensitivity may require the Nectin-4 antibody to be titrated for optimal performance.

Immunogen

Amino acids 53-94 (FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAY) from the human protein were used as the immunogen for the Nectin-4 antibody.

Storage

After reconstitution, the Nectin-4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Nectin-4 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.