- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
NARG1 Antibody / NAA15 (R32787)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
|
R32787 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 449 |
| Availability | 1-3 business days |
| Species Reactivity | Human, Mouse, Rat |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide |
| UniProt | Q9BXJ9 |
| Localization | Cytoplasmic, Nuclear |
| Applications | Western Blot : 0.5-1ug/ml Immunohistochemistry (FFPE) : 2-5ug/ml |
| Limitations | This NARG1 antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
NARG1 antibody targets N alpha acetyltransferase 15, encoded by the NAA15 gene and also known as NARG1. NAA15 is a cytoplasmic protein that functions as an essential auxiliary subunit of the NatA N terminal acetyltransferase complex. This complex is responsible for N terminal acetylation of a large proportion of newly synthesized proteins, a common co-translational modification that influences protein stability, localization, and interaction networks. NAA15 primarily localizes to the cytoplasm and ribosome-associated compartments, where it supports efficient acetylation during protein synthesis.
Functionally, N alpha acetyltransferase 15 acts as a regulatory and scaffolding component rather than a catalytic enzyme. It associates with the catalytic subunit NAA10 to stabilize the NatA complex and facilitate substrate recognition. Through this role, NAA15 indirectly affects a wide range of cellular processes, including protein quality control, signal transduction, and cytoskeletal organization. A NARG1 antibody supports studies focused on protein maturation and co-translational modification pathways.
NAA15 is broadly expressed across tissues and cell types, reflecting the fundamental importance of N terminal acetylation in cellular biology. Expression is particularly relevant in proliferative and developmentally active tissues, where high levels of protein synthesis demand precise regulation of nascent polypeptides. Alterations in NatA complex activity can have widespread downstream effects due to the large number of client proteins modified by this system.
From a disease-relevance perspective, dysregulation of NAA15 has been linked to developmental disorders and cancer biology. Variants in NAA15 have been associated with neurodevelopmental abnormalities, highlighting its importance in nervous system development. Changes in expression or function of NatA components have also been investigated in tumorigenesis, where altered protein acetylation may contribute to abnormal growth and signaling behavior.
At the molecular level, N alpha acetyltransferase 15 contains conserved regions required for interaction with NAA10 and other components of the NatA complex. Its function and apparent behavior in biochemical assays can be influenced by protein complex formation and post-translational regulation without changes to primary sequence. NARG1 antibody reagents support research applications focused on protein acetylation biology, translational control, and disease-associated alterations in proteome regulation, with NSJ Bioreagents providing reagents intended for research use.
Optimal dilution of the NARG1 antibody should be determined by the researcher.
Amino acids 244-287 (ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY) from the human protein were used as the immunogen for the NARG1 antibody.
After reconstitution, the NARG1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz
