• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> NANOG Antibody / Pluripotency Marker NANOG

NANOG Antibody / Pluripotency Marker NANOG (R32790)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32790 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
›
Western blot testing of 1) rat ovary, 2) mouse ovary and 3) human MCF7 cell lysate with NANOG/Pluripotency Marker NANOG antibody at 0.5ug/ml. Predicted molecular weight: 35-45 kDa.
Flow cytometry testing of human A549 cells with NANOG antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= NANOG antibody.
Flow cytometry testing of human PC-3 cells with NANOG antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= NANOG antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt Q9H9S0
Applications Western Blot : 0.5-1ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This NANOG antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC, ELISA
    Reactivity : Human
  • Applications : IHC
    Reactivity : Human
  • Applications : WB, IF, IHC, FACS, ELISA
    Reactivity : Human
    Pred. Reactivity : Primate
  • Applications : IF, FACS, IHC, ELISA
    Reactivity : Human
    Pred. Reactivity : Bovine, Primate
  • Applications : WB, IF, ELISA
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Human
  • Applications : DB, ELISA
    Reactivity : Human
  • Applications : IF, DB, ELISA
    Reactivity : Human
    Pred. Reactivity : Primate
  • Applications : WB, ELISA (peptide)
    Reactivity : Mouse
  • Applications : WB, IHC, ELISA (peptide), EIA
    Reactivity : Human
  • Applications : WB, IHC, IF, ELISA (peptide), EIA
    Reactivity : Human
    Pred. Reactivity : Dog, Pig

Description

NANOG antibody recognizes Pluripotency Marker NANOG, a transcription factor encoded by the NANOG gene that plays a central role in maintaining pluripotency and self-renewal in embryonic stem cells. NANOG is a homeobox-containing protein that functions primarily in the nucleus, where it regulates gene expression programs critical for early embryonic development and stem cell identity. NANOG antibody is widely used in stem cell biology to identify pluripotent cells and to study mechanisms governing cellular reprogramming and differentiation.

NANOG operates within a core transcriptional network that includes OCT4 and SOX2, forming an interconnected regulatory circuit that sustains pluripotency. By activating genes associated with stemness and repressing differentiation-associated pathways, NANOG helps preserve the undifferentiated state. Loss of NANOG expression typically promotes lineage commitment, while sustained expression supports self-renewal capacity. Because of this pivotal function, NANOG antibody is frequently applied in studies of induced pluripotent stem cells, embryonic stem cells, and developmental biology.

Beyond early development, aberrant NANOG expression has been reported in multiple cancer types, where it has been associated with tumor stem-like properties, resistance to therapy, and enhanced proliferative potential. In these contexts, NANOG antibody is used to investigate cancer stem cell populations and transcriptional programs linked to tumor progression. NANOG protein is predominantly nuclear, and immunostaining typically demonstrates nuclear localization consistent with its function as a transcription factor. Detection of NANOG expression provides insight into pluripotency status, differentiation potential, and stem cell-associated signaling pathways.

Application Notes

Optimal dilution of the NANOG antibody should be determined by the researcher.

Immunogen

Amino acids 115-155 (QRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQK) from the human protein were used as the immunogen for the NANOG antibody.

Storage

After reconstitution, the NANOG antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Nanog antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.