• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> NADPH oxidase 4 Antibody / NOX4

NADPH oxidase 4 Antibody / NOX4 (RQ4166)

  Catalog No Formulation Size Price (USD)  
Image RQ4166 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Immunofluorescent staining of FFPE human U-2 OS cells with NADPH oxidase 4 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of 1) human 293T, 2) human U-87 MG, 3) human SH-SY5Y, 4) human U-251, 5) human U-2 OS, 6) human HeLa, 7) human T-47D and 8) monkey COS-7 cell lysate with NADPH oxidase 4 antibody. Expected molecular weight: ~65 kDa, 75-80 kDa.
Availability 1-3 business days
Species Reactivity Human, Monkey
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt Q9NPH5
Localization Cytoplasmic and cell surface
Applications Western Blot : 0.5-1ug/ml
Immunofluorescence : 5ug/ml
Limitations This NADPH oxidase 4 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

NADPH oxidase 4 is an enzyme that in humans is encoded by the NOX4 gene, and is a member of the NOX family of NADPH oxidases. This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS). The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants.

Application Notes

Optimal dilution of the NADPH oxidase 4 antibody should be determined by the researcher.

Immunogen

Amino acids ILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLL were used as the immunogen for the NADPH oxidase 4 antibody.

Storage

After reconstitution, the NADPH oxidase 4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.