- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
NADPH Oxidase 4 Antibody recognizes NADPH oxidase 4 (NOX4), an enzyme belonging to the NADPH oxidase family that catalyzes the production of reactive oxygen species for intracellular signaling. Unlike many other NOX family members that require activation by multiple regulatory proteins, NOX4 is constitutively active, with its enzymatic activity governed primarily by expression level and intracellular localization. The protein is broadly expressed in the kidney, cardiovascular system, lung, liver, and numerous additional tissues, where it participates in redox-dependent regulation of cellular homeostasis. NSJ Bioreagents supplies NADPH Oxidase 4 Antibody for dependable detection of this important oxidoreductase in a wide variety of research applications.
NOX4 is unusual among NADPH oxidases because it predominantly generates hydrogen peroxide rather than superoxide, allowing it to function as a sustained regulator of intracellular signaling. Reactive oxygen species produced by NOX4 influence transforming growth factor beta signaling, hypoxia responses, extracellular matrix remodeling, angiogenesis, autophagy, apoptosis, and cellular differentiation. Through reversible oxidation of signaling proteins, NOX4 modulates kinase activity, transcription factor function, and gene expression, thereby integrating oxidative signals with cellular adaptation and survival. Consequently, NADPH Oxidase 4 Antibody is widely used to investigate redox biology, oxidative stress, and reactive oxygen species-mediated signaling pathways.
Aberrant NOX4 expression has been associated with numerous diseases, including pulmonary fibrosis, chronic kidney disease, diabetic nephropathy, cardiac hypertrophy, vascular remodeling, neurodegenerative disorders, and several forms of cancer. Sustained NOX4 activity contributes to inflammation, tissue fibrosis, epithelial-to-mesenchymal transition, and pathological remodeling, making the enzyme an important therapeutic target in both chronic inflammatory and fibrotic diseases. Researchers also investigate NOX4 to understand mechanisms controlling wound healing, metabolism, cellular senescence, and tumor progression, further highlighting its importance across multiple fields of biomedical research.
A NADPH Oxidase 4 Antibody is a valuable reagent for investigating oxidative stress, reactive oxygen species generation, redox signaling, and cellular homeostasis. By enabling reliable detection of NOX4, a NADPH Oxidase 4 Antibody supports research into fibrosis, cardiovascular biology, renal disease, cancer progression, and the molecular pathways that regulate oxidative signaling.
For a broader overview of this reactive oxygen species-producing enzyme and additional validated reagents, visit our NOX4 Antibody / Reactive Oxygen Species Enzyme Antibody page.
Optimal dilution of the NADPH Oxidase 4 Antibody / NOX4 Antibody should be determined by the researcher.
Amino acids ILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLL were used as the immunogen for the NADPH oxidase 4 antibody.
After reconstitution, the NADPH oxidase 4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
NOX4 antibody, RENOX antibody, Renal NADPH Oxidase antibody, Kidney Oxidase antibody, KOX-1 antibody, NOH-4 antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.