- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
MUNC18-1 Antibody recognizes Syntaxin Binding Protein 1 (STXBP1), a highly conserved neuronal protein that is indispensable for regulated synaptic vesicle exocytosis. MUNC18-1 belongs to the Sec1/Munc18 protein family and functions as a master regulator of neurotransmitter release by controlling the assembly and activity of the SNARE complex. Through its interaction with syntaxin-1, MUNC18-1 coordinates synaptic vesicle docking, priming, and membrane fusion, allowing rapid calcium-dependent neurotransmitter release at presynaptic terminals. Because of this essential role in synaptic transmission, MUNC18-1 Antibody is widely used to investigate neuronal communication, synaptic physiology, vesicle trafficking, and neurological disease mechanisms.
MUNC18-1 is expressed predominantly in neurons throughout the central and peripheral nervous systems, where it is required for both the development and maintenance of functional synapses. Loss or disruption of STXBP1 impairs synaptic vesicle fusion and markedly reduces neurotransmitter release. Human mutations in STXBP1 have been linked to severe neurodevelopmental disorders including early infantile epileptic encephalopathy, developmental delay, intellectual disability, autism spectrum disorders, and movement disorders. These discoveries have established MUNC18-1 as an important biomarker for neuroscience research and have increased the value of MUNC18-1 Antibody for studies examining synaptic dysfunction, epilepsy, and neurodegeneration. In addition to neuronal tissues, STXBP1 continues to be investigated for broader roles in regulated membrane trafficking and secretory pathways.
At the molecular level, MUNC18-1 binds syntaxin in both its closed and SNARE-complex-associated conformations, facilitating proper assembly of the exocytotic machinery while regulating vesicle fusion efficiency. The protein also interacts with synaptobrevin, SNAP25, Munc13 proteins, and other components that coordinate neurotransmitter release. Dynamic regulation through phosphorylation and protein-protein interactions enables neurons to rapidly modulate synaptic strength in response to changing physiological conditions. Consequently, MUNC18-1 Antibody is frequently employed to examine presynaptic organization, vesicle cycling, synaptic plasticity, and the molecular mechanisms governing neuronal secretion. It is equally valuable for evaluating experimental models of epilepsy, neurodevelopmental disease, and other disorders affecting synaptic transmission.
NSJ Bioreagents offers carefully validated MUNC18-1 Antibody products suitable for applications including western blotting, immunohistochemistry, immunofluorescence, immunoprecipitation, and flow cytometry. These antibodies provide reliable detection of endogenous STXBP1 across multiple sample types and experimental systems. Researchers studying synaptic vesicle biology, neuronal development, neurotransmitter release, and diseases caused by defective synaptic transmission can utilize MUNC18-1 Antibody to investigate protein localization, expression levels, and functional regulation in both basic and translational neuroscience research.
Explore additional antibodies for synaptic proteins, neurotransmitter signaling and nervous system research on our Neuroscience Antibodies page.
Optimal dilution of the MUNC18-1 Antibody / Synaptic Vesicle Exocytosis Protein Antibody should be determined by the researcher.
Amino acids KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD of human MUNC18-1 were used as the immunogen for the MUNC18-1 antibody.
After reconstitution, the MUNC18-1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
STXBP1 antibody, Syntaxin Binding Protein 1 antibody, Unc18-1 antibody, N-Sec1 antibody, Protein unc-18 homolog 1 antibody, Neuronal Sec1 antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.