- Tel: 858.663.9055
- Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Mucin 2, also known as MUC2, is a protein that in humans is encoded by the MUC2 gene. This gene encodes a member of the mucin protein family. It is mapped to 11p15.5. Mucin 2 is particularly prominent in the gut where it is secreted from goblet cells in the epithelial lining into the lumen of the large intestine. There, mucin 2, along with small amounts of related-mucin proteins, polymerizes into a gel of which 80% by weight is oligosaccharide side-chains that are added as post-translational modifications to the mucin proteins. This gel provides an insoluble mucous barrier that serves to protect the intestinal epithelium. The primary function of the MUC2 gene product is to provide a protective barrier between the epithelial surfaces and the gut lumen. There is decreased expression of MUC2 in colonic cancer and defective polymerization of secreted mucin in ulcerative colitis.
Optimal dilution of the Mucin 2 antibody should be determined by the researcher.
Amino acids DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD from the human protein were used as the immunogen for the Mucin 2 antibody.
After reconstitution, the Mucin 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.