- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
MUC3 Antibody (A/B) (R32385)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
R32385 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 429 |
|
| Availability | 1-3 business days |
| Species Reactivity | Human |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide |
| UniProt | Q02505 |
| Localization | Cytoplasmic, membranous |
| Applications | Western blot : 0.5-1ug/ml |
| Limitations | This MUC3 antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
MUC3 consists of two genes, MUC3A and MUC3B, each encoding membrane-bound mucins possessing 2 epidermal growth factor-like domains. The MUC3 gene is mapped to chromosome 7. It was showed that synthetic peptide-mediated upregulation of MUC3 dramatically inhibited adherence of enteropathogenic E. coli or enterohemorrhage E. coli serotype O157:H7 to HT-29 human intestinal epithelial cells. Peptide stimulation altered expression of a number of transcription factors, including upregulation of SP1, CREB1, and CDX2. These transcription factors bound to consensus sites in the MUC3 promoter upon peptide stimulation and likely mediated MUC3 upregulation.
Optimal dilution of the MUC3 antibody should be determined by the researcher.
Amino acids DLNDNTSQAYRDFNKTFWNQMQKIFADMQGFTFK from human MUC3A/B were used as the immunogen for the MUC3 antibody.
After reconstitution, the MUC3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz
Citations(10)