• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> MMP-9 Antibody

MMP-9 Antibody (R32445)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32445 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of rat NRK cell lysate with MMP-9 antibody at 0.5ug/ml. Predicted molecular weight: 92/67-80 kDa (precursor/mature forms).
›
Western blot testing of rat NRK cell lysate with MMP-9 antibody at 0.5ug/ml. Predicted molecular weight: 92/67-80 kDa (precursor/mature forms).
IHC testing of FFPE mouse spleen tissue with MMP-9 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.
IHC testing of FFPE rat spleen tissue with MMP-9 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.
Availability 1-3 business days
Species Reactivity Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P50282
Localization Cytoplasmic, nuclear, secreted
Applications Western blot : 0.5-1ug/ml
IHC (FFPE) : 1-2ug/ml
Limitations This MMP-9 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Matrix metallopeptidase 9 (MMP-9), also known as 92 kDa type IV collagenase, 92 kDa gelatinase or gelatinase B (GELB), is an enzyme that in humans is encoded by the MMP9 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.

Application Notes

Optimal dilution of the MMP-9 antibody should be determined by the researcher.

Immunogen

Amino acids RRGGKALLISRERIWKFDLKSQKVDPQSVTRLDNEFS were used as the immunogen for the MMP-9 antibody.

Storage

Prior to reconstitution, store at 4oC. After reconstitution, the MMP-9 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all MMP9 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.