• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> MMP-8 Antibody

MMP-8 Antibody (R32022)

  Catalog No Formulation Size Price (USD)  
Image R32022 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of human 1) K562 and 2) Jurkat cell lysate with MMP-8 antibody. Expected molecular weight: 55 kDa (latent), 46, 42 kDa (active).
IHC testing of FFPE human appendicitis tissue with MMP-8 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P22894
Localization Cytoplasmic
Applications Western Blot : 0.1-0.5ug/ml
IHC (FFPE) : 0.5-1ug/ml
ELISA : 0.1-0.5ug/ml (human protein tested); request BSA-free format for coating
Limitations This MMP-8 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P, ELISA (protein)
    Reactivity : Mouse, Rat

Description

MMP-8 (Matrix metalloproteinase 8) is a member of the family of matrix metalloproteinases. It is distinct from the collagenase of skin fibroblasts and synovial cells in substrate specificity and immunologic crossreactivity. MMP8 is mapped to 11q21-q22. MMP-8 is an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, is expressed by leukocytes and chorionic cytotrophoblast cells. The enzyme exhibits 58% homology to human fibroblast collagenase and has the same domain structure. It consists of a 20-residue signal peptide, and an 80-residue propeptide that is lost on autolytic activation by cleavage of an M-L bond. MMP8 was found to possess 57% identity with the deduced protein sequence for fibroblast collagenase with 72% chemical similarity. Matrix metalloproteinases (MMPs) have fundamental roles in tumor progression, but most clinical trials with MMP inhibitors have not shown improvements in individuals with cancer. MMP8 has a paradoxical protective role in cancer and provides a genetic model to evaluate the molecular basis of gender differences in cancer susceptibility.

Application Notes

Optimal dilution of the MMP-8 antibody should be determined by the researcher.

Immunogen

Amino acids NYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQ of human MMP8 were used as the immunogen for the MMP-8 antibody.

Storage

After reconstitution, the MMP-8 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.