- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
MKK3 Antibody / p38 MAP Kinase Kinase Antibody recognizes mitogen-activated protein kinase kinase 3 (MKK3/MAP2K3), a dual-specificity protein kinase that functions as a principal upstream activator of the p38 mitogen-activated protein kinase signaling pathway. MKK3 is activated in response to inflammatory cytokines, environmental stress, DNA damage, osmotic shock, and oxidative stress, where it phosphorylates p38 MAP kinases to regulate cellular responses including inflammation, apoptosis, differentiation, proliferation, and stress adaptation. Because MKK3 occupies a central position within stress-responsive MAPK signaling, MKK3 Antibody / p38 MAP Kinase Kinase Antibody is widely used to investigate inflammatory signaling, oncology, immunology, and cellular stress responses.
MKK3 belongs to the MAP kinase kinase family and selectively activates p38 alpha, beta, gamma, and delta MAP kinases through dual phosphorylation of conserved threonine and tyrosine residues. Activated p38 proteins subsequently regulate numerous downstream kinases and transcription factors involved in cytokine production, cell cycle regulation, immune activation, and programmed cell death. Through this signaling cascade, MKK3 serves as an important molecular relay that converts extracellular stress signals into coordinated changes in gene expression and cellular behavior. Tight regulation of MKK3 activity is therefore essential for maintaining tissue homeostasis and mounting appropriate responses to injury and infection.
Beyond inflammatory signaling, MKK3 contributes to diverse physiological processes including innate immunity, tissue repair, cellular senescence, embryonic development, and metabolic regulation. Activation of the MKK3-p38 pathway influences macrophage activation, epithelial differentiation, angiogenesis, and responses to hypoxia and oxidative damage. Because the pathway integrates signals from numerous receptors and stress-sensing mechanisms, MKK3 has become an important regulator of both normal physiology and disease progression across multiple organ systems.
Aberrant MKK3 signaling has been implicated in numerous pathological conditions including cancer, autoimmune diseases, chronic inflammatory disorders, fibrosis, cardiovascular disease, and neurodegeneration. Dysregulated activation of the p38 MAPK pathway can promote persistent inflammation, abnormal cell survival, or altered responses to cellular stress, making MKK3 an attractive therapeutic target in both inflammatory and neoplastic diseases. Accordingly, MKK3 is frequently studied in drug discovery, biomarker development, and investigations of stress-induced signaling networks.
NSJ Bioreagents' MKK3 Antibody / p38 MAP Kinase Kinase Antibody supports investigations into p38 MAPK signaling, inflammatory cytokine signaling, cellular stress responses, apoptosis, differentiation, innate immunity, cancer biology, and targeted therapeutic development. Reliable detection of MKK3 enables researchers to study one of the central signaling kinases responsible for linking environmental stress and inflammatory stimuli to downstream transcriptional and cellular responses.
Explore additional antibodies involved in p38 MAPK signaling, stress-responsive kinase pathways, and targeted cancer research on our Cancer Antibodies page.
Optimal dilution of the MKK3 antibody should be determined by the researcher.
Amino acids AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS of human MAP2K3/MEK3 were used as the immunogen for the MKK3 antibody.
After reconstitution, the MKK3 Antibody / p38 MAP Kinase Kinase Antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
MKK3 antibody, MAP2K3 antibody, Mitogen-Activated Protein Kinase Kinase 3 antibody, p38 MAP Kinase Kinase antibody, Stress-Activated Kinase antibody, Dual Specificity Kinase antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.