- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Tyrosine-protein kinase Lyn is a protein that in humans is encoded in humans by the LYN gene. It is mapped to 8q12.1. Lyn is a member of the Src family of protein tyrosine kinases. In various hematopoietic cells, Lyn has emerged as a key enzyme involved in the regulation of cell activation. Lyn has been described to have an inhibitory role in myeloid lineage proliferation.
Optimal dilution of the LYN antibody should be determined by the researcher.
Amino acids 470-501 (DELYDIMKMCWKEKAEERPTFDYLQSVLDDFY) were used as the immunogen for the LYN antibody.
After reconstitution, the LYN antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.