• Tel: 858.663.9055
  • Email: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> LRIG3 Antibody

LRIG3 Antibody (R32545)

  Catalog No Formulation Size Price (USD)  
R32545 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 329
Western blot testing of 1) rat testis and 2) human HepG2 lysate with LRIG3 antibody at 0.5ug/ml. Observed molecular weight: ~123 kDa (precursor), 140-170 kDa (glycosylated).
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q6UXM1
Localization Cytoplasmic, membranous
Applications Western blot : 0.5-1ug/ml
Limitations This LRIG3 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

LRIG3 (leucine-rich repeats and Ig-like domains-3) is a 140 kDa type I transmembrane glycoprotein member of the mammalian LRIG glycoprotein family. It shares 46.8% and 54.0% amino acid identity with LRIG1 and LRIG2, respectively, with highest conservation in the extracellular, transmembrane, and membrane-proximal sequences. This gene is mapped to chromosome 12q13.2. LRIG3 may play a role in craniofacial and inner ear morphogenesis during embryonic development. It also may act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1.

Application Notes

Differences in protocols and secondary/substrate sensitivity may require the LRIG3 antibody to be titrated for optimal performance.

Immunogen

Amino acids 428-465 (NAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQ from the human protein were used as the immunogen for the LRIG3 antibody.

Storage

After reconstitution, the LRIG3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code:


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.