• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> LIMK Antibody / LIM Kinase 1

LIMK Antibody / LIM Kinase 1 (R32135)

  Catalog No Formulation Size Price (USD)  
Image R32135 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of 1) rat brain, 2) mouse stomach, human 3) HeLa, 4) U87 and 5) SKOV lysate with LIMK antibody. Expeccted/observed molecular weight ~72 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P53667
Applications Western Blot : 0.1-0.5ug/ml
ELISA : 0.1-0.5ug/ml
Limitations This LIMK antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

LIM domain kinase 1 is an enzyme that in humans is encoded by the LIMK1 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs, a central PDZ domain, and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development.

Application Notes

Optimal dilution of the LIMK antibody should be determined by the researcher.

Immunogen

Amino acids KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR of human LIMK1 were used as the immunogen for the LIMK antibody.

Storage

After reconstitution, the LIMK antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.