• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> LIFR Antibody / LIF Receptor

LIFR Antibody / LIF Receptor (R32098)

  Catalog No Formulation Size Price (USD)  
Image R32098 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of human 1) SW620, 2) COLO320 and 3) HepG2 cell lysate with LIFR antibody. Expected/observed molecular weight ~124/190 kDa (unmodified/glycosylated).
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P42702
Applications Western Blot : 0.1-0.5ug/ml
Limitations This LIFR antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

LIFR also known as CD118 (Cluster of Differentiation 118), is a subunit of a receptor for leukemia inhibitory factor. This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5;8)(p13;q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene.

Application Notes

Optimal dilution of the LIFR antibody should be determined by the researcher.

Immunogen

Amino acids EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE of human LIFR were used as the immunogen for the LIFR antibody.

Storage

After reconstitution, the LIFR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.