- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
LCK antibody is useful for studying LCK, a member of the SRC family of non-receptor protein tyrosine kinases that serves as a critical regulator of T-cell signaling. LCK is best known for its role in initiating signaling events downstream of the T-cell receptor (TCR), where it phosphorylates key signaling molecules and triggers pathways that control lymphocyte activation, proliferation, differentiation, and immune responses. Through these activities, LCK functions as a central component of adaptive immune signaling and T-cell biology.
LCK is predominantly expressed in T lymphocytes and related immune cell populations, where it acts as one of the earliest signaling mediators activated following antigen recognition. Upon engagement of the T-cell receptor complex, LCK phosphorylates immunoreceptor tyrosine-based activation motifs and other downstream signaling proteins, initiating molecular cascades that regulate gene expression, cytokine production, cellular communication, and immune cell function. Because of its pivotal role in T-cell activation, LCK has become one of the most extensively studied kinases in immunology research.
As a T-cell signaling kinase, LCK coordinates pathways that govern immune surveillance, antigen-specific responses, and lymphocyte development. Proper regulation of LCK activity is essential for maintaining balanced immune function and effective adaptive immunity. The kinase therefore occupies a central position within signaling networks that determine how T cells recognize and respond to external stimuli. Analysis of LCK expression can provide valuable insight into mechanisms controlling immune activation and signal transduction.
Beyond its role in mature T-cell function, LCK contributes to developmental processes associated with thymocyte maturation and lymphocyte differentiation. Signaling pathways regulated by LCK influence cellular fate decisions, proliferation, and survival during immune system development. Consequently, LCK is frequently investigated in studies of immunology, hematopoiesis, developmental biology, signal transduction, and immune-related diseases.
LCK also serves as an important model protein for understanding kinase-mediated signaling mechanisms. As a member of the SRC kinase family, it participates in phosphorylation-dependent pathways that regulate cellular communication and biologic responses. Research involving LCK has contributed significantly to the understanding of how immune receptors transmit signals and how intracellular kinase networks control cellular behavior.
LCK antibodies are commonly used in immunohistochemistry, western blotting, immunofluorescence, flow cytometry, and related protein detection applications. These reagents support investigations of T-cell signaling, adaptive immunity, lymphocyte development, immune regulation, kinase biology, and signal transduction pathways. LCK antibody tools help researchers characterize the molecular mechanisms that govern immune cell activation and the signaling networks that coordinate adaptive immune responses.
Researchers studying T-cell activation, adaptive immunity, lymphocyte development, and immune signaling pathways may also be interested in our broader Immunology Antibody collection.
Optimal dilution of the LCK Antibody / T-Cell Signaling Kinase Antibody should be determined by the researcher.
Amino acids ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ of human Lymphocyte-specific protein tyrosine kinase were used as the immunogen for the LCK antibody.
After reconstitution, the LCK antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Lymphocyte-Specific Protein Tyrosine Kinase Antibody, p56Lck Antibody, T-Cell Signaling Kinase Antibody, SRC Family Kinase Antibody, T-Lymphocyte Activation Protein Antibody, Immune Signaling Kinase Antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.