• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> LCK Antibody / T-Cell Signaling Kinase Antibody

LCK Antibody / T-Cell Signaling Kinase Antibody (R31894)

  Catalog No Formulation Size Price (USD)  
Image R31894 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
LCK Antibody Jurkat, Thymus and Spleen Western Blot. Western blot analysis of human Jurkat cells (lane 1), rat thymus (lane 2), rat spleen (lane 3), mouse thymus (lane 4), and mouse spleen (lane 5) using LCK Antibody / T-Cell Signaling Kinase Antibody demonstrates distinct bands at approximately 58 kDa, consistent with the expected molecular weight of LCK. LCK is a SRC family tyrosine kinase that serves as a critical initiator of T-cell receptor signaling, regulating pathways involved in lymphocyte activation, differentiation, proliferation, and adaptive immune responses. Detection of LCK in Jurkat cells and lymphoid tissues including thymus and spleen is consistent with its established role in T-cell development and immune signaling. The observed expression pattern supports the utility of LCK as a marker of T-cell-associated signal transduction and adaptive immune function.
LCK Antibody Human Tonsil IHC. Immunohistochemical staining of FFPE human tonsil tissue using LCK Antibody demonstrates prominent membranous and cytoplasmic HRP-DAB brown staining within lymphocyte-rich regions. The staining pattern is consistent with expression of LCK, a SRC family tyrosine kinase that functions as a critical initiator of T-cell receptor signaling and adaptive immune activation. LCK-mediated signaling regulates lymphocyte activation, proliferation, differentiation, and immune communication, making it an essential component of T-cell biology. The strong staining observed in tonsillar lymphoid populations supports the established role of LCK in immune signaling pathways and adaptive immune function. HIER: boil paraffin sections in pH 6, 10 mM citrate buffer for 20 minutes and allow to cool prior to staining.
LCK Antibody Mouse Lymph Node IHC. Immunohistochemical staining of FFPE mouse lymph node tissue using LCK Antibody / T-Cell Signaling Kinase Antibody demonstrates prominent membranous and cytoplasmic HRP-DAB brown staining within dense lymphoid cell populations. The staining pattern is consistent with expression of LCK, a SRC family tyrosine kinase that serves as a critical initiator of T-cell receptor signaling and downstream adaptive immune responses. LCK regulates signaling pathways involved in lymphocyte activation, proliferation, differentiation, and immune communication. The strong signal observed within lymph node-associated lymphocytes supports the established role of LCK in T-cell biology and immune system regulation. HIER: boil paraffin sections in pH 6, 10 mM citrate buffer for 20 minutes and allow to cool prior to staining.
LCK Antibody Rat Lymph Node IHC. Immunohistochemical staining of FFPE rat lymph node tissue using LCK Antibody / T-Cell Signaling Kinase Antibody demonstrates strong membranous and cytoplasmic HRP-DAB brown staining throughout lymphocyte-rich regions. The staining pattern is consistent with expression of LCK, a SRC family tyrosine kinase that functions as a critical initiator of T-cell receptor signaling and adaptive immune activation. LCK-mediated phosphorylation events regulate pathways involved in lymphocyte activation, proliferation, differentiation, and immune communication. The prominent staining observed within lymphoid cell populations supports the established role of LCK in T-cell biology, immune surveillance, and adaptive immune responses. HIER: boil paraffin sections in pH 6, 10 mM citrate buffer for 20 minutes and allow to cool prior to staining.
LCK Antibody Mouse Spleen IHC. Immunohistochemical staining of frozen mouse spleen tissue using LCK Antibody / T-Cell Signaling Kinase Antibody demonstrates prominent membranous and cytoplasmic staining within lymphocyte-rich splenic compartments. The staining pattern is consistent with expression of LCK, a SRC family tyrosine kinase that functions as a critical initiator of T-cell receptor signaling and adaptive immune activation. LCK regulates phosphorylation-dependent signaling pathways that control lymphocyte activation, proliferation, differentiation, and immune communication. The strong staining observed in splenic immune cell populations supports the established role of LCK in T-cell biology, immune surveillance, and adaptive immune responses.
LCK Antibody U-2 OS Cell IF/ICC. Immunofluorescent staining of FFPE human U-2 OS cells using LCK Antibody / T-Cell Signaling Kinase Antibody demonstrates cytoplasmic and membrane-associated red fluorescence, consistent with expression of LCK. LCK is a SRC family tyrosine kinase that functions as a critical initiator of phosphorylation-dependent signaling pathways involved in lymphocyte activation, cellular communication, and immune signal transduction. The observed staining pattern is consistent with the intracellular localization expected for a non-receptor tyrosine kinase and supports the utility of this antibody for detection of LCK in immunofluorescence applications. Nuclei are counterstained with DAPI (blue). HIER: boil tissue sections in pH 6, 10 mM citrate buffer for 20 minutes and allow to cool before testing.
LCK Antibody HepG2 Cell FACS. Flow cytometric analysis of human HepG2 cells using LCK antibody demonstrates a clear rightward shift of the LCK-positive population (blue) relative to the isotype control (green) and unstained cells (red), consistent with expression of LCK. LCK is a SRC family tyrosine kinase that functions as a critical initiator of T-cell receptor signaling and phosphorylation-dependent signal transduction pathways. As a key regulator of immune cell activation and cellular communication, LCK participates in signaling networks that influence lymphocyte function, cellular responses to external stimuli, and downstream transcriptional activation. The observed fluorescence shift supports the utility of this antibody for flow cytometric detection of LCK. Red=cells alone; Green=isotype control; Blue=LCK antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P06239
Localization Cytoplasmic
Applications Western Blot : 0.1-0.5ug/ml
Immunohistochemistry (FFPE) : 0.5-1ug/ml
Flow Cytometry : 1-3ug/10^6 cells
Immunocytochemistry : 2-4ug/ml
Limitations This LCK Antibody / T-Cell Signaling Kinase Antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, ELISA
    Reactivity : Human
  • Applications : WB
    Reactivity : Human
    Rab Mono Image
  • Applications : WB, IHC-P, FACS, IF
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Mouse
  • Applications : IHC, FACS, WB, ELISA
    Reactivity : Human
  • Applications : IHC, IF, FACS, WB, ELISA
    Reactivity : Human, Mouse, Rat
  • Applications : WB, ELISA (peptide)
    Reactivity : Human, Rat, Pig
    Pred. Reactivity : Mouse, Dog, Cow
  • Applications : WB
    Reactivity : Zebrafish

Description

LCK antibody is useful for studying LCK, a member of the SRC family of non-receptor protein tyrosine kinases that serves as a critical regulator of T-cell signaling. LCK is best known for its role in initiating signaling events downstream of the T-cell receptor (TCR), where it phosphorylates key signaling molecules and triggers pathways that control lymphocyte activation, proliferation, differentiation, and immune responses. Through these activities, LCK functions as a central component of adaptive immune signaling and T-cell biology.

LCK is predominantly expressed in T lymphocytes and related immune cell populations, where it acts as one of the earliest signaling mediators activated following antigen recognition. Upon engagement of the T-cell receptor complex, LCK phosphorylates immunoreceptor tyrosine-based activation motifs and other downstream signaling proteins, initiating molecular cascades that regulate gene expression, cytokine production, cellular communication, and immune cell function. Because of its pivotal role in T-cell activation, LCK has become one of the most extensively studied kinases in immunology research.

As a T-cell signaling kinase, LCK coordinates pathways that govern immune surveillance, antigen-specific responses, and lymphocyte development. Proper regulation of LCK activity is essential for maintaining balanced immune function and effective adaptive immunity. The kinase therefore occupies a central position within signaling networks that determine how T cells recognize and respond to external stimuli. Analysis of LCK expression can provide valuable insight into mechanisms controlling immune activation and signal transduction.

Beyond its role in mature T-cell function, LCK contributes to developmental processes associated with thymocyte maturation and lymphocyte differentiation. Signaling pathways regulated by LCK influence cellular fate decisions, proliferation, and survival during immune system development. Consequently, LCK is frequently investigated in studies of immunology, hematopoiesis, developmental biology, signal transduction, and immune-related diseases.

LCK also serves as an important model protein for understanding kinase-mediated signaling mechanisms. As a member of the SRC kinase family, it participates in phosphorylation-dependent pathways that regulate cellular communication and biologic responses. Research involving LCK has contributed significantly to the understanding of how immune receptors transmit signals and how intracellular kinase networks control cellular behavior.

LCK antibodies are commonly used in immunohistochemistry, western blotting, immunofluorescence, flow cytometry, and related protein detection applications. These reagents support investigations of T-cell signaling, adaptive immunity, lymphocyte development, immune regulation, kinase biology, and signal transduction pathways. LCK antibody tools help researchers characterize the molecular mechanisms that govern immune cell activation and the signaling networks that coordinate adaptive immune responses.

Researchers studying T-cell activation, adaptive immunity, lymphocyte development, and immune signaling pathways may also be interested in our broader Immunology Antibody collection.

Application Notes

Optimal dilution of the LCK Antibody / T-Cell Signaling Kinase Antibody should be determined by the researcher.

Immunogen

Amino acids ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ of human Lymphocyte-specific protein tyrosine kinase were used as the immunogen for the LCK antibody.

Storage

After reconstitution, the LCK antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Alternate Names

Lymphocyte-Specific Protein Tyrosine Kinase Antibody, p56Lck Antibody, T-Cell Signaling Kinase Antibody, SRC Family Kinase Antibody, T-Lymphocyte Activation Protein Antibody, Immune Signaling Kinase Antibody

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.