• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> LCAT Antibody

LCAT Antibody (R31981)

  Catalog No Formulation Size Price (USD)  
Image R31981 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat brain, 2) mouse testis, 3) human HepG2 and 4) human HeLa lysate with LCAT antibody. Observed molecular weight: 50~75 kDa depending on glycosylation level.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P16301
Applications Western blot : 0.1-0.5ug/ml
Limitations This LCAT antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Human, Rat
  • Applications : WB, ELISA (peptide)
    Reactivity : Human, Mouse, Rat, Dog, Pig, Cow
  • Applications : WB, ELISA (peptide)
    Reactivity : Human
  • Applications : FACS, IF, IHC-P, WB
    Reactivity : Human

Description

LCAT (Lecithin: Cholesterol Acyltransferase), is an enzyme that converts free cholesterol into cholesteryl ester. Azoulay et al. (1987) used a cDNA clone corresponding to LCAT to assign the locus to 16q22 through the analysis of DNA from somatic cell hybrids and in situ hybridization. LCAT plays an important role in lipoprotein metabolism, especially in the process termed 'reverse cholesterol transport.' The enzyme is synthesized in the liver and circulates in blood plasma as a complex with components of high density lipoprotein (HDL). Cholesterol from peripheral cells is transferred to HDL particles, esterified through the action of LCAT on HDL, and incorporated into the core of the lipoprotein. The cholesterol ester is thereby transported to the liver (Jonas, 2000).

Application Notes

Optimal dilution of the LCAT antibody should be determined by the researcher.

Immunogen

Amino acids QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR of mouse LCAT were used as the immunogen for the LCAT antibody.

Storage

After reconstitution, the LCAT antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.