• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Kv1.4 Antibody

Kv1.4 Antibody (R32018)

  Catalog No Formulation Size Price (USD)  
Image R32018 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of human 1) HeLa, 2) COLO320, 3) HT1080 and 4) PANC cell lysate with Kv1.4 antibody. Expected/observed molecular weight ~73 kDa.
IHC testing of FFPE human lung cancer tissue with Kv1.4 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P22459
Localization Cytoplasmic
Applications Western Blot : 0.1-0.5ug/ml
IHC (FFPE) : 0.5-1ug/ml
Limitations This Kv1.4 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Human, Mouse, Rat

Description

Potassium voltage-gated channel subfamily A member 4, also known as Kv1.4 or PCN2, mediates transmembrane potassium transport in excitable membranes. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. [UniProt]

Application Notes

Optimal dilution of the Kv1.4 antibody should be determined by the researcher.

Immunogen

Amino acids SEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAK of human Kv1.4 were used as the immunogen for the Kv1.4 antibody.

Storage

After reconstitution, the Kv1.4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.