- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Kv1.2 Antibody recognizes Kv1.2, also known as Potassium Voltage-Gated Channel Subfamily A Member 2 (KCNA2), a membrane-spanning potassium channel that plays a critical role in regulating neuronal membrane excitability and electrical signaling. Kv1.2 belongs to the Shaker-related Kv1 family of voltage-gated potassium channels and mediates delayed rectifier potassium currents that promote membrane repolarization following action potentials. By controlling potassium ion flux across the plasma membrane, Kv1.2 influences action potential duration, firing frequency, synaptic transmission, and neuronal network activity. Consequently, Kv1.2 Antibody is widely used to investigate neuronal electrophysiology, ion channel biology, and nervous system function.
Kv1.2 is highly expressed throughout the central nervous system, particularly within the cerebral cortex, hippocampus, cerebellum, brainstem, and spinal cord. The channel is enriched at axons, presynaptic terminals, juxtaparanodal regions of myelinated fibers, and other specialized membrane domains where it regulates neuronal excitability. Kv1.2 frequently assembles with other Kv1 family members to form heterotetrameric potassium channels possessing distinct electrophysiological properties. Through these interactions, Kv1.2 contributes to precise control of synaptic transmission, neurotransmitter release, and neuronal communication. As a result, Kv1.2 Antibody has become an important tool for studies examining ion channel distribution and neural circuit function.
Altered KCNA2 expression or function has been associated with epilepsy, developmental and epileptic encephalopathies, hereditary ataxia, peripheral nerve disorders, and other neurological diseases characterized by abnormal neuronal excitability. Both gain-of-function and loss-of-function KCNA2 variants can disrupt membrane repolarization and impair normal electrical signaling within the nervous system. In addition to inherited disorders, Kv1.2 dysfunction has been investigated in neurodegenerative diseases, traumatic nervous system injury, and chronic pain. Because voltage-gated potassium channels are essential regulators of excitable tissues, Kv1.2 remains an important target for studies exploring disease mechanisms and the development of ion channel-directed therapeutics.
NSJ Bioreagents offers highly validated Kv1.2 Antibody products for reliable detection of endogenous Kv1.2 in nervous system tissues and cultured cells. These antibodies support investigations into neuronal membrane excitability, potassium channel biology, synaptic transmission, and neurological disease while enabling researchers to characterize Kv1.2 expression, localization, and regulation. Whether studying normal electrical signaling or disorders involving dysfunctional ion channel activity, Kv1.2 Antibody provides a dependable tool for neuroscience and ion channel research.
Learn more about proteins that regulate neuronal excitability, synaptic transmission and nervous system function on our Neuroscience Antibodies page.
Optimal dilution of the Kv1.2 Antibody / Voltage-Gated Potassium Channel Antibody should be determined by the researcher.
Amino acids NNSNEDFREENLKTANCTLANTNYVNITKMLTDV of human Kv1.2 were used as the immunogen for the Kv1.2 antibody.
After reconstitution, the Kv1.2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
KCNA2 antibody, Potassium Voltage-Gated Channel Subfamily A Member 2 antibody, Voltage-Gated Potassium Channel Kv1.2 antibody, Delayed Rectifier Potassium Channel antibody, Potassium Channel Subunit Kv1.2 antibody, BK2 antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.