- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Ku70 (XRCC6) is a DNA end-binding protein that functions as a central component of the non-homologous end joining (NHEJ) DNA repair pathway responsible for repair of DNA double-strand breaks. Ku70 forms a heterodimeric complex with Ku80 (XRCC5) that recognizes exposed DNA termini and recruits additional DNA repair machinery including DNA-dependent protein kinase catalytic subunit (DNA-PKcs). Ku70 Antibody is useful for investigations involving DNA damage response pathways, genomic stability regulation, double-strand break repair, and DNA repair-associated cellular signaling mechanisms.
Ku70 antibody, also referred to as XRCC6 antibody and DNA end binding protein antibody in the literature, recognizes a ubiquitously expressed nuclear DNA repair protein encoded on chromosome 22q13.2. Ku70 localizes predominantly to the nucleus where it binds free DNA ends generated during DNA damage, V(D)J recombination, oxidative stress, ionizing radiation exposure, and replication-associated genomic injury. The Ku70/Ku80 heterodimer functions as one of the earliest DNA damage sensing complexes involved in NHEJ-mediated repair pathway activation.
Ku70 Antibody / DNA End Binding Protein Antibody is uniquely positioned for studies involving DNA damage sensing and repair pathway initiation. This rabbit polyclonal antibody supports detection of XRCC6-associated DNA repair machinery involved in recognition and stabilization of DNA double-strand break termini. The polyclonal nature of the antibody may additionally support recognition of multiple Ku70-associated epitopes across native and DNA-bound protein conformations involved in cellular DNA repair responses.
Ku70 participates in recruitment and stabilization of DNA-PK-associated repair complexes required for efficient non-homologous end joining activity. In addition to its canonical DNA repair role, Ku70 has been associated with telomere maintenance, chromatin organization, apoptotic regulation through interaction with BAX, and cellular stress response signaling pathways. Altered Ku70 expression or localization has been associated with genomic instability, radiation sensitivity, impaired DNA repair activity, cancer progression, and resistance to DNA damaging therapies.
In tissue-based and cellular detection systems, Ku70 expression commonly demonstrates strong nuclear localization consistent with its role in DNA end recognition and repair-associated chromatin interaction. DNA damage-inducing conditions may alter Ku70 recruitment dynamics and subnuclear distribution patterns associated with active DNA repair foci. Because XRCC6 functions as a central DNA end recognition factor within the NHEJ pathway, it serves as an important marker for investigations involving DNA repair competency and genomic maintenance mechanisms.
This rabbit polyclonal Ku70 Antibody supports research involving DNA end binding, double-strand break repair pathways, genomic stability regulation, DNA-PK-associated repair signaling, chromatin-associated DNA damage responses, apoptosis-associated stress signaling, and non-homologous end joining biology. The antibody may be incorporated into tissue-based and cellular investigations examining DNA repair-associated cellular regulation in normal and diseased tissues.
Explore additional DNA damage response and repair pathway markers on our Signal Transduction Antibodies page, including antibodies targeting double-strand break repair, NHEJ signaling, and genomic stability pathways.
Optimal dilution of the Ku70 Antibody / DNA End Binding Protein Antibody should be determined by the researcher.
Amino acids AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD of human Ku70 were used as the immunogen for the Ku70 antibody.
After reconstitution, the Ku70 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
XRCC6 antibody, Ku70 antibody, ATP-dependent DNA helicase 2 subunit 1 antibody, DNA end binding protein antibody, DNA repair protein Ku70 antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.