• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Ku70 Antibody

Ku70 Antibody [clone 9B6] (RQ6388)

  Catalog No Formulation Size Price (USD)  
Image RQ6388 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
IHC staining of FFPE human lymphoma with Ku70 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human rectal cancer tissue with Ku70 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human breast cancer tissue with Ku70 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human ovarian serous adenocarcinoma tissue with Ku70 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human U-2 OS cells with Ku70 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) HeLa, 2) A549, 3) HepG2 and 4) MCF7 cell lysate with Ku70 antibody. Predicted molecular weight ~70 kDa.
Flow cytometry testing of human ThP-1 cells with Ku70 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Ku70 antibody.
Availability 1-3 business days
Species Reactivity Human
Format Purified
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG2b
Clone Name 9B6
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P12956
Localization Nuclear
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Immunofluorescence (FFPE) : 5ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This Ku70 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : IHC-P, WB
    Reactivity : Human
    Rab Mono Image
  • Applications : WB, IHC-P, IF, FACS
    Reactivity : Human
  • Applications : WB, IHC-P, ICC, IF, FACS
    Reactivity : Human
  • Applications : WB, IHC, FACS, ELISA
    Reactivity : Human, Mouse
  • Applications : WB, IHC, FACS, IF, ELISA
    Reactivity : Human
  • Applications : IHC, FACS, IF, WB, ELISA
    Reactivity : Human
  • Applications : WB, ELISA (peptide)
    Reactivity : Human
  • Applications : WB, IHC-P, IF, FACS
    Reactivity : Human

Description

XRCC6 (X-Ray Repair, Complementing Defective, In Chinese Hamster, 6), also called Ku70, G22P1 or TLAA, is a protein that in humans, is encoded by the XRCC6 gene. In addition, the XRCC6 gene encodes subunit p70 of the p70/p80 autoantigen which consists of 2 proteins of molecular mass of approximately 70,000 and 80,000 daltons that dimerize to form a 10 S DNA-binding complex. The XRCC6 gene is mapped to 22q13.2. XRCC6 and Mre11 are differentially expressed during meiosis. XRCC6 interacts with Baxa, a mediator of mitochondrial-dependent apoptosis. Disruption of both FANCC and XRCC6 suppressed sensitivity to crosslinking agents, diminished chromosome breaks, and reversed defective homologous recombination. Ku70 binds directly to free DNA ends, committing them to NHEJ repair. In early meiotic prophase, however, when meiotic recombination is most probably initiated, Mre11 was abundant, whereas XRCC6 was not detectable.

Application Notes

Optimal dilution of the Ku70 antibody should be determined by the researcher.

Immunogen

Amino acids AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD were used as the immunogen for the Ku70 antibody.

Storage

After reconstitution, the Ku70 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.