• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> KIM1 Antibody / HAVCR1

KIM1 Antibody / HAVCR1 (R32305)

  Catalog No Formulation Size Price (USD)  
Image R32305 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of human 1) HeLa, 2) PANC, 3) HepG2 and 4) A549 cell lysate with KIM1 antibody. Predicted molecular weight~39 kDa, routinely observed at ~55 kDa (Ref 1), and a heavily glycosylated mature form at ~100 kDa (Ref 2).
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q96D42
Applications Western Blot : 0.1-0.5ug/ml
Limitations This KIM1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Kidney injury molecule 1, also known as HAVCR1, HAVCR or TIM1, is a protein that in humans is encoded by the HAVCR1 gene. It may play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4 (By similarity). May play a role in kidney injury and repair. [UniProt]

Application Notes

Optimal dilution of the KIM1 antibody should be determined by the researcher.

Immunogen

Amino acids QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD of human HAVCR1 were used as the immunogen for the KIM1 antibody.

Storage

After reconstitution, the KIM1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.