• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> KCNA3 Antibody / Kv1.3

KCNA3 Antibody / Kv1.3 (R32012)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32012 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat brain, 2) mouse brain, human 3) K562, 4) HeLa and 5) 22RV1 lysate with KCNA3 antibody. Expected molecular weight ~64 kDa, observed here at ~55 kDa.
Western blot testing of 1) rat brain, 2) mouse brain, human 3) K562, 4) HeLa and 5) 22RV1 lysate with KCNA3 antibody. Expected molecular weight ~64 kDa, observed here at ~55 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P22001
Applications Western blot : 0.1-0.5ug/ml
Limitations This KCNA3 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Potassium voltage-gated channel, shaker-related subfamily, member 3, also known as KCNA3 or Kv1.3, is a protein that in humans is encoded by the KCNA3 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1. And Kv1.3 has been reported to be expressed in the inner mitochondrial membrane in lymphocytes. The apoptotic protein Bax has been suggested to insert into theouter mitochondrial membrane and occlude the pore of Kv1.3 via a lysine residue. Thus, Kv1.3 modulation may be one of many mechanisms that contribute to apoptosis.

Application Notes

Optimal dilution of the KCNA3 antibody should be determined by the researcher.

Immunogen

Amino acids EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ of human KCNA3 were used as the immunogen for the KCNA3 antibody.

Storage

After reconstitution, the KCNA3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all KCNA3 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.