- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
JNK2 antibody targets c-Jun N-terminal kinase 2, encoded by the MAPK9 gene. c-Jun N-terminal kinase 2 is a serine-threonine protein kinase that belongs to the mitogen-activated protein kinase (MAPK) family, which transduces extracellular stress signals into intracellular responses. JNK family members are activated by environmental stress, inflammatory cytokines, and growth factor signaling, playing central roles in cellular adaptation and survival.
Functionally, c-Jun N-terminal kinase 2 participates in phosphorylation of transcription factors such as c-Jun and other AP-1 family members, thereby regulating gene expression programs linked to apoptosis, proliferation, and immune responses. JNK2 activity contributes to stress-activated signaling cascades that influence both acute signaling outcomes and longer-term transcriptional regulation. A JNK2 antibody supports studies focused on MAPK pathway dynamics, stress signaling, and transcriptional control mechanisms downstream of kinase activation.
JNK2 is expressed across a wide range of tissues and cell types, with prominent roles in immune cells, epithelial cells, and neuronal systems. Subcellular localization is primarily cytoplasmic under basal conditions, with translocation to the nucleus following activation to regulate transcription factor targets. Localization and activation status can vary depending on stimulus type, duration, and cellular context, reflecting the kinase's role as a signaling integrator rather than a constitutively active enzyme.
From a disease relevance perspective, dysregulation of c-Jun N-terminal kinase 2 signaling has been investigated in inflammatory disorders, neurodegenerative disease, and cancer, where altered stress response pathways can influence cell fate decisions. Structurally, JNK2 contains a conserved MAP kinase domain responsible for substrate recognition and catalytic activity, along with regulatory regions that govern activation and interaction with scaffold proteins. JNK2 antibody reagents support research applications examining stress-activated signaling pathways, with NSJ Bioreagents providing tools intended for research use.
Optimal dilution of the JNK2 antibody should be determined by the researcher.
Amino acids RNYVENRPKYPGIKFEELFPDWIFPSESERDK of human JNK2a/b were used as the immunogen for the JNK2 antibody.
After reconstitution, the JNK2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.