• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> JAK1 Antibody

JAK1 Antibody (R32701)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32701 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat kidney, 2) mouse kidney and 3) human HeLa lysate with JAK1 antibody at 0.5ug/ml. Predicted molecular weight ~133 kDa.
Western blot testing of 1) rat kidney, 2) mouse kidney and 3) human HeLa lysate with JAK1 antibody at 0.5ug/ml. Predicted molecular weight ~133 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P23458
Applications Western Blot : 0.5-1ug/ml
Limitations This JAK1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IP
    Reactivity : Human, Rat
  • Applications : WB, ICC/IF, IP
    Reactivity : Human, Rat
  • Applications : WB, ELISA
    Reactivity : Mouse
  • Applications : WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Mouse
  • Applications : WB, ELISA
    Reactivity : Human, Mouse

Description

JAK1 (Janus Kinase 1) is a human tyrosine kinase protein essential for signaling for certain type I and type II cytokines. It is a member of a new class of PTKs that are a large family of proteins characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain--hence the name Janus. The JAK1 gene is mapped to 1p31.3. JAK1 is also important for transducing a signal by type I (IFN-a/b) and type II (IFN-g) interferons, and members of the IL-10 family via type II cytokine receptors. Additionally, Jak1 plays a critical role in initiating responses to multiple major cytokine receptor families. Loss of Jak1 is lethal in neonatal mice, possibly due to difficulties suckling. Expression of JAK1 in cancer cells enables individual cells to contract, potentially allowing them to escape their tumor and metastasize to other parts of the body.

Application Notes

Optimal dilution of the JAK1 antibody should be determined by the researcher.

Immunogen

Amino acids 78-115 (FALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTN) from the human protein were used as the immunogen for the JAK1 antibody.

Storage

After reconstitution, the JAK1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all JAK1 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.