- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Isocitrate Dehydrogenase Antibody 16H7 / IDH1 Protein Antibody recognizes isocitrate dehydrogenase 1 (IDH1), an NADP-dependent metabolic enzyme found predominantly in the cytoplasm and peroxisomes. IDH1 catalyzes the oxidative decarboxylation of isocitrate to alpha-ketoglutarate while generating NADPH. Through these products, IDH1 contributes to intermediary metabolism, reductive biosynthesis, antioxidant defense, and maintenance of cellular redox balance.
IDH1 Protein is functionally distinct from the mitochondrial NAD-dependent isocitrate dehydrogenases involved directly in the tricarboxylic acid cycle. Cytosolic IDH1 provides an important source of NADPH for lipid biosynthesis and cellular defense against oxidative stress. The protein also contains a peroxisomal targeting signal, supporting localization to peroxisomes where NADPH is required for several metabolic reactions. These properties connect IDH1 activity with lipid metabolism, redox homeostasis, and adaptation to changing cellular metabolic demands.
IDH1 has received considerable attention in cancer research because recurrent somatic mutations affecting arginine 132 occur in several malignancies. These mutations confer neomorphic enzymatic activity that enables mutant IDH1 to convert alpha-ketoglutarate into D-2-hydroxyglutarate. Accumulation of this oncometabolite can alter alpha-ketoglutarate-dependent cellular processes and contribute to widespread metabolic and epigenetic changes. General IDH1 Protein Antibody reagents are therefore useful complements to mutation-specific antibodies when investigating IDH1 expression independently of a particular R132 mutation.
Clone 16H7 is a mouse monoclonal antibody generated against a defined peptide sequence from the human IDH1 protein. NSJ Bioreagents offers this Isocitrate Dehydrogenase Antibody for researchers investigating IDH1 expression, cellular metabolism, redox regulation, and cancer-associated metabolic alterations. An Isocitrate Dehydrogenase Antibody provides a clone-defined reagent for studying the expression and biology of this important NADP-dependent metabolic enzyme.
For an alternative monoclonal clone targeting IDH1, see our IDH1 Antibody IDH1/1152 / Cytosolic Isocitrate Dehydrogenase Antibody page.
Optimal dilution of the Isocitrate Dehydrogenase Antibody 16H7 / IDH1 Protein Antibody should be determined by the researcher.
Amino acids KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK from the human protein were used as the immunogen for the Isocitrate Dehydrogenase Antibody 16H7.
After reconstitution, the Isocitrate Dehydrogenase Antibody 16H7 can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
IDH1 antibody, Isocitrate dehydrogenase 1 antibody, Isocitrate dehydrogenase antibody, IDH1 protein antibody, Cytosolic isocitrate dehydrogenase antibody, Isocitrate dehydrogenase [NADP] cytoplasmic antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.