• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Isocitrate Dehydrogenase Antibody 16H7 / IDH1 Protein Antibody

Isocitrate Dehydrogenase Antibody 16H7 / IDH1 Protein Antibody [clone 16H7] (RQ6022)

  Catalog No Formulation Size Price (USD)  
Image RQ6022 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Isocitrate Dehydrogenase Antibody 16H7 Staining of U-2 OS Osteosarcoma Cells IF. Immunofluorescence staining of FFPE human U-2 OS osteosarcoma cells using Isocitrate Dehydrogenase Antibody, clone 16H7 (green), with DAPI nuclear counterstain (blue). Sections were heat treated by steaming in pH 6 citrate buffer for 20 min before staining. IDH1 Protein Antibody labeling is predominantly cytoplasmic, surrounding the DAPI-positive nuclei and consistent with the principal cellular localization of IDH1.
Isocitrate Dehydrogenase Antibody 16H7 Detects IDH1 in Human Cancer Cell Lines WB. Western blot analysis of human 1) HepG2, 2) Caco-2, 3) U-87 MG, 4) THP-1, 5) HeLa, 6) K562, 7) PC-3 and 8) HEK293 cell lysates using Isocitrate Dehydrogenase Antibody, clone 16H7. A prominent band is detected at approximately 46 kDa across all eight samples, consistent with the predicted molecular weight of IDH1. The relatively clean banding demonstrates recognition of endogenous IDH1 Protein across a diverse panel of human cell lines.
Isocitrate Dehydrogenase Antibody 16H7 Detects IDH1 in Rat and Mouse Samples WB. Western blot analysis of 1) rat liver tissue, 2) rat RH35 hepatoma cells and 3) mouse liver tissue using Isocitrate Dehydrogenase Antibody, clone 16H7. A strong, discrete band is detected at approximately 46 kDa in all three lanes, consistent with the predicted molecular weight of IDH1. The comparable target bands demonstrate recognition of endogenous IDH1 Protein in both rat and mouse samples with minimal additional reactivity.
Isocitrate Dehydrogenase Antibody 16H7 Detection in Caco-2 Colorectal Cancer Cells by FACS. Flow cytometry analysis of human Caco-2 colorectal adenocarcinoma cells using Isocitrate Dehydrogenase Antibody, clone 16H7. Cells were fixed with 4% paraformaldehyde, permeabilized, blocked with 10% normal goat serum, and incubated with antibody at 1 ug/million cells for 30 min at 20oC. DyLight 488-conjugated goat anti-mouse IgG was used as the secondary antibody. The antibody-stained population (blue) shows a clear rightward fluorescence shift relative to the mouse IgG isotype control (green) and unlabeled cells (red), demonstrating intracellular detection of IDH1 Protein.
Species Reactivity Human, Mouse, Rat
Format Purified
Host Mouse
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG1
Clone Name 16H7
Purity Affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt O75874
Applications Western Blot : 0.5-1ug/ml
Immunofluorescence : 2-4ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This Isocitrate Dehydrogenase Antibody 16H7 / IDH1 Protein Antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Isocitrate Dehydrogenase Antibody 16H7 / IDH1 Protein Antibody recognizes isocitrate dehydrogenase 1 (IDH1), an NADP-dependent enzyme found predominantly in the cytosol and also associated with peroxisomes. IDH1 catalyzes the oxidative decarboxylation of isocitrate to 2-oxoglutarate, also called alpha-ketoglutarate, while converting NADP+ to NADPH. This reaction connects IDH1 with cellular carbon metabolism, biosynthetic processes, and maintenance of cellular reducing capacity.

IDH1 is one of two NADP-dependent isocitrate dehydrogenases in mammalian cells. In contrast to mitochondrial IDH2, IDH1 functions primarily in the cytoplasmic compartment and contains a peroxisomal targeting sequence that supports localization to peroxisomes. Cytosolic Isocitrate Dehydrogenase contributes substantially to NADPH production, while peroxisomal IDH1 can provide reducing equivalents for metabolic reactions occurring within that organelle.

IDH1 is also extensively investigated in cancer biology because recurrent somatic mutations can alter its catalytic activity. Mutations involving arginine 132 are especially important and produce metabolic effects that differ from the normal function of IDH1. General detection of IDH1 protein therefore provides a complementary approach to mutation-specific reagents designed to recognize individual IDH1 variants.

Clone 16H7 is a mouse monoclonal antibody generated against a defined peptide sequence from human IDH1. The target protein is approximately 46-47 kDa. NSJ Bioreagents offers this Isocitrate Dehydrogenase Antibody as a clone-defined reagent for researchers investigating IDH1 expression, NADPH metabolism, cellular redox regulation, and disease-associated changes in isocitrate dehydrogenase biology.

An Isocitrate Dehydrogenase Antibody can support studies of IDH1 protein expression and the metabolic pathways associated with cytosolic and peroxisomal NADP-dependent isocitrate dehydrogenase activity.

For an alternative monoclonal clone with additional tissue-based validation, see our IDH1 Antibody IDH1/1152 / Cytosolic Isocitrate Dehydrogenase Antibody page.

Application Notes

Optimal dilution of the Isocitrate Dehydrogenase Antibody 16H7 / IDH1 Protein Antibody should be determined by the researcher.

Immunogen

Amino acids KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK from the human protein were used as the immunogen for the Isocitrate Dehydrogenase Antibody 16H7.

Storage

After reconstitution, the Isocitrate Dehydrogenase Antibody 16H7 can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Alternate Names

IDH1 antibody, Isocitrate dehydrogenase 1 antibody, Isocitrate dehydrogenase [NADP] cytoplasmic antibody, NADP-dependent isocitrate dehydrogenase cytosolic antibody, IDP antibody, IDPC antibody

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.