- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
IRF5 Antibody recognizes Interferon Regulatory Factor 5, an immune response regulator encoded by the IRF5 gene that coordinates innate immune activation and inflammatory gene expression. As a member of the interferon regulatory factor family, IRF5 functions downstream of Toll-like receptor signaling to regulate transcription of type one interferons and numerous cytokines involved in host defense. Activation of IRF5 promotes nuclear translocation and transcriptional control of genes required for antiviral immunity, inflammatory responses, and immune cell activation. NSJ Bioreagents supplies this IRF5 Antibody to support reliable detection of this immune response regulator in diverse research applications.
IRF5 plays an essential role in macrophages, dendritic cells, monocytes, and B lymphocytes, where it integrates signals from pattern recognition receptors to shape both innate and adaptive immune responses. Through regulation of cytokines including tumor necrosis factor, interleukin 6, and interleukin 12, IRF5 influences immune cell communication and promotes proinflammatory responses during infection and tissue injury. Because of these activities, IRF5 Antibody is frequently used to investigate immune regulation, inflammatory signaling, macrophage activation, and cellular responses to microbial pathogens.
Aberrant IRF5 activity has been associated with numerous human diseases, including systemic lupus erythematosus, rheumatoid arthritis, inflammatory bowel disease, multiple sclerosis, and several malignancies. Genetic polymorphisms within the IRF5 locus are among the strongest inherited risk factors for multiple autoimmune disorders, underscoring the importance of tightly regulated IRF5 signaling. IRF5 is also being investigated in the tumor microenvironment, where immune regulation and inflammatory signaling influence cancer progression and therapeutic response. Consequently, IRF5 Antibody provides a valuable tool for studies spanning immunology, inflammation, oncology, and translational research.
IRF5 Antibody enables sensitive detection of this immune response regulator in studies of innate immunity, cytokine signaling, inflammatory transcriptional networks, and host defense mechanisms. Analysis of IRF5 expression and localization contributes to a better understanding of immune regulation in both normal physiology and disease, making this antibody a dependable reagent for investigating inflammatory and immune-mediated pathways.
For a broader overview of IRF5 biology and additional validated products, visit our IRF5 Antibody / Innate Immune Transcription Factor Antibody page.
Optimal dilution of the IRF5 Antibody / Immune Response Regulator Antibody should be determined by the researcher.
Amino acids RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ of human IRF5 were used as the immunogen for the IRF5 antibody.
After reconstitution, the IRF5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Immune Response Regulator antibody, Interferon Regulatory Factor 5 antibody, IRF-5 antibody, Innate Immune Transcription Factor antibody, Interferon Response Factor 5 antibody, Virus Activated Transcription Factor antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.