• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> IRF5 Antibody

IRF5 Antibody (R32219)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32219 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat intestine, 2) human HeLa, 3) human COLO320, 4) mouse NIH3T3 and 5) mouse HEPA1-6 lysate with IRF5 antibody. Expected/observed molecular weight ~57 kDa.
›
Western blot testing of 1) rat intestine, 2) human HeLa, 3) human COLO320, 4) mouse NIH3T3 and 5) mouse HEPA1-6 lysate with IRF5 antibody. Expected/observed molecular weight ~57 kDa.
IHC testing of FFPE human breast cancer with IRF5 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse spleen with IRF5 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat spleen with IRF5 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q13568
Localization Nuclear, cytoplasmic
Applications Western blot : 0.1-0.5ug/ml
IHC (FFPE) : 0.5-1ug/ml
Limitations This IRF5 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IF, FACS, ELISA
    Reactivity : Human
    Pred. Reactivity : Bovine
  • Applications : WB, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat, Cow

Description

Interferon regulatory factor 5, also called IRF5 or SLEB10, is a protein that in humans is encoded by the IRF5 gene. This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity.

Application Notes

Optimal dilution of the IRF5 antibody should be determined by the researcher.

Immunogen

Amino acids RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ of human IRF5 were used as the immunogen for the IRF5 antibody.

Storage

After reconstitution, the IRF5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all IRF5 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.