• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Involucrin Antibody

Involucrin Antibody (R31905)

  Catalog No Formulation Size Price (USD)  
Image R31905 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of human 1) A431 and 2) A549 lysate with Involucrin antibody. Predicted molecular weight ~68 kDa but can be observed at up to ~140 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P07476
Applications Western Blot : 0.1-0.5ug/ml
Limitations This Involucrin antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Involucrin is a protein component of human skin and in humans is encoded by the IVL gene. It is a highly reactive, soluble, transglutaminase substrate protein present in keratinocytes of epidermisand other stratified squamous epithelia. It first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase thus helping in the formation of an insoluble envelope beneath the plasma membrane functioning as a glutamyl donor during assembly of the cornified envelope. Additionally, Involucrin is synthesised in the stratum spinosum and cross linked in the stratum granulosum by the transglutaminase enzyme that makes it highly stable. Thus it provides structural support to the cell, thereby allowing the cell to resist invasion by micro-organisms.

Application Notes

Optimal dilution of the Involucrin antibody should be determined by the researcher.

Immunogen

Amino acids QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK of human Involucrin were used as the immunogen for the Involucrin antibody.

Storage

After reconstitution, the Involucrin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.