• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Integrin alpha 4 Antibody / ITGA4

Integrin alpha 4 Antibody / ITGA4 (R31960)

  Catalog No Formulation Size Price (USD)  
Image R31960 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of 1) rat liver, 2) rat kidney, human 3) Jurkat, 4) 22RV1, 5) HepG2, 6) SMMC lysate with Integrin alpha 4 antibody. Predicted molecular weight ~115 kDa, but may be observed at higher molecular weights due to glycosylation.
IHC testing of FFPE human breast cancer with Integrin alpha 4 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P13612
Localization Cytoplasmic, membrane
Applications Western Blot : 0.1-0.5ug/ml
IHC (FFPE) : 0.5-1ug/ml
Limitations This Integrin alpha 4 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

ITGA4/Integrin alpha4 is an integrin alpha subunit. It makes up half of the alpha4beta1 lymphocyte homing receptor. The product of this gene belongs to the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an alpha 4 chain. Unlike other integrin alpha chains, alpha 4 neither contains an I-domain, nor undergoes disulfide-linked cleavage. Alpha 4 chain associates with either beta 1 chain or beta 7 chain. ITGA4 is also mapped to 2q31-q32 by fluorescence in situ hybridization.

Application Notes

Optimal dilution of the Integrin alpha 4 antibody should be determined by the researcher.

Immunogen

Amino acids MWKAGFFKRQYKSILQEENRRDSWSYINSK of human ITGA4 were used as the immunogen for the Integrin alpha 4 antibody.

Storage

After reconstitution, the Integrin alpha 4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.