• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Insulin Receptor Antibody / INSR

Insulin Receptor Antibody / INSR (R32540)

  Catalog No Formulation Size Price (USD)  
Image R32540 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of 1) rat kidney and 2) human HepG2 lysate with Insulin Receptor antibody at 0.5ug/ml. Predicted/observed molecular weight: ~156 kDa.
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P06213
Applications Western Blot : 0.5-1ug/ml
Limitations This Insulin Receptor antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Insulin receptor is a tetramer of 2 alpha and 2 beta subunits that are coded by a single gene and are joined by disulfide bonds, a mechanism parallel to that of its ligand, insulin. It belongs to the large class of tyrosine kinase receptors. The insulin receptor gene is mapped to 19p13.2. The insulin receptor mediates their activity by causing the addition of a phosphate group to particular tyrosines on certain proteins within a cell. The INSR gene spans more than 120 kb and has 22 exons. Functional studies of the INSR SNPs show no effect on mRNA levels or splicing in peripheral blood leukocytes or on binding of insulin to mononuclear cells.

Application Notes

Differences in protocols and secondary/substrate sensitivity may require the Insulin Receptor antibody to be titrated for optimal performance.

Immunogen

Amino acids 38-76 (MDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDL) from the human protein were used as the immunogen for the Insulin Receptor antibody.

Storage

After reconstitution, the Insulin Receptor antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.