• Tel: 858.663.9055
  • Email: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> iNOS Antibody / NOS2

iNOS Antibody / NOS2 (R32711)

  Catalog No Formulation Size Price (USD)  
R32711 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 329
Western blot testing of human HeLa cell lysate with iNOS antibody at 0.5ug/ml. Predicted molecular weight ~130 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P35228
Applications Western Blot : 0.5-1ug/ml
Limitations This iNOS antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Nitric oxide synthase, inducible is an enzyme that in humans is encoded by the NOS2 gene. Nitric oxide (NO) is a messenger molecule with diverse functions throughout the body. In the brain and peripheral nervous system, NO displays many properties of a neurotransmitter; it is implicated in neurotoxicity associated with stroke and neurodegenerative diseases, neural regulation of smooth muscle, including peristalsis, and penile erection. Three different NOS isoforms have been identified which fall into two distinct types, constitutive and inducible. The inducible NOS (iNOS) isoform is expressed in a variety of cell types and tissues in response to inflammatory agents and cytokines. The human iNOS (NOS2) gene is approximately 37 kb in length and consists of 26 exons and 25 introns. NOS2-derived NO is a prerequisite for cytokine signaling and function in innate immunity.

Application Notes

Optimal dilution of the iNOS antibody should be determined by the researcher.

Immunogen

Amino acids 1088-1126 (ARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHED) from the human protein were used as the immunogen for the iNOS antibody.

Storage

After reconstitution, the iNOS antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code:


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.