- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
IL-18R Beta Antibody / IL18RAP (RQ6190)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
RQ6190 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 429 |
|
| Availability | 1-3 business days |
| Species Reactivity | Human |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Affinity purified |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose and 0.0125% sodium azide |
| UniProt | O95256 |
| Applications | Western blot : 1-2ug/ml |
| Limitations | This IL-18R Beta antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
Interleukin 18 receptor accessory protein, also known as IL18RAP and CDw218b (cluster of differentiation w218b), is a human gene. The protein encoded by this gene is an accessory subunit of the heterodimeric receptor for interleukin 18 (IL18), a proinflammatory cytokine involved in inducing cell-mediated immunity. This protein enhances the IL18-binding activity of the IL18 receptor and plays a role in signaling by IL18. Mutations in this gene are associated with Crohn's disease and inflammatory bowel disease, and susceptibility to celiac disease and leprosy. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.
Optimal dilution of the IL-18R Beta antibody should be determined by the researcher.
Amino acids SIFELQAAVNLALDDQTLKLILIKFCYFQEPESLPHLVKKALR from the human protein were used as the immunogen for the IL-18R Beta antibody.
After reconstitution, the IL-18R Beta antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz