• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> IL-18R Beta Antibody / IL18RAP

IL-18R Beta Antibody / IL18RAP (RQ6190)

  Catalog No Formulation Size Price (USD)  
Image RQ6190 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of human 1) HL60 and 2) A549 cell lysate with IL-18R Beta antibody. Predicted molecular weight ~72 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.0125% sodium azide
UniProt O95256
Applications Western Blot : 1-2ug/ml
Limitations This IL-18R Beta antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Interleukin 18 receptor accessory protein, also known as IL18RAP and CDw218b (cluster of differentiation w218b), is a human gene. The protein encoded by this gene is an accessory subunit of the heterodimeric receptor for interleukin 18 (IL18), a proinflammatory cytokine involved in inducing cell-mediated immunity. This protein enhances the IL18-binding activity of the IL18 receptor and plays a role in signaling by IL18. Mutations in this gene are associated with Crohn's disease and inflammatory bowel disease, and susceptibility to celiac disease and leprosy. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.

Application Notes

Optimal dilution of the IL-18R Beta antibody should be determined by the researcher.

Immunogen

Amino acids SIFELQAAVNLALDDQTLKLILIKFCYFQEPESLPHLVKKALR from the human protein were used as the immunogen for the IL-18R Beta antibody.

Storage

After reconstitution, the IL-18R Beta antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.