- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
IKZF1 Antibody / Lymphoid Development Transcription Factor Antibody recognizes IKZF1, also known as Ikaros, a zinc finger DNA-binding transcription factor that serves as a master regulator of hematopoietic and lymphoid development. IKZF1 belongs to the Ikaros family of transcription factors and controls the expression of genes required for lineage commitment, cellular differentiation, and maturation of immune cell populations. Through its ability to regulate chromatin organization and transcriptional activity, IKZF1 plays a central role in establishing and maintaining normal hematopoietic function. Because of its importance in immune system development, IKZF1 has become one of the most widely studied transcription factors in hematology and immunology research.
IKZF1 Antibody is widely used for investigating lymphocyte development and immune cell differentiation. Expression of IKZF1 is closely associated with hematopoietic stem cells, lymphoid progenitors, and developing B- and T-cell populations. The protein functions as both a transcriptional activator and repressor, coordinating complex gene expression programs that determine immune cell identity and function. Loss or disruption of IKZF1 activity can impair normal lymphoid differentiation and alter immune system development, highlighting its essential biological role.
IKZF1 Antibody is particularly valuable for studies of hematopoiesis and stem cell biology. During blood cell development, IKZF1 regulates the balance between self-renewal, lineage commitment, and cellular maturation. By controlling developmental gene networks, IKZF1 helps guide progenitor cells toward specialized immune cell fates while maintaining appropriate transcriptional programs throughout differentiation. These functions make IKZF1 an important marker for investigations of developmental biology and hematopoietic regulation.
IKZF1 Antibody also supports research involving chromatin remodeling and transcriptional control. Ikaros proteins recruit chromatin-modifying complexes and influence higher-order chromatin structure, allowing them to coordinate large gene expression programs that affect proliferation, differentiation, and cellular function. Through these mechanisms, IKZF1 integrates developmental signals with transcriptional regulation and contributes to maintenance of immune homeostasis.
IKZF1 Antibody has significant relevance in leukemia and lymphoma research. Genetic alterations, deletions, mutations, or abnormal expression of IKZF1 have been associated with several hematologic malignancies, particularly acute lymphoblastic leukemia (ALL). Changes in IKZF1 activity can disrupt normal differentiation pathways and contribute to malignant transformation. Consequently, IKZF1 is frequently evaluated as a biomarker of lymphoid lineage development and as a target for studies of leukemia pathogenesis and disease progression.
IKZF1 Antibody is additionally useful for investigations of immune regulation, hematologic disease, and developmental signaling pathways. Because IKZF1 occupies a central position in the genetic networks that control lymphocyte development and immune system formation, it provides valuable insight into both normal hematopoiesis and disease-associated alterations in transcriptional regulation.
IKZF1 Antibody supports research involving lymphocyte differentiation, hematopoietic stem cells, immune system development, chromatin remodeling, transcriptional regulation, leukemia, lymphoma, and developmental biology. As a master regulator of lymphoid lineage commitment, IKZF1 remains an essential target for understanding immune cell development and hematologic disease mechanisms.
Researchers studying lymphocyte development, hematopoiesis, immune cell differentiation, and transcriptional regulation of the immune system may also be interested in our comprehensive collection of Immunology Antibodies.
Optimal dilution of the IKZF1 Antibody / Lymphoid Development Transcription Factor Antibody should be determined by the researcher.
Amino acids LKEEHRAYDLLRAASENSQDALRVVSTSGEQM of human IKZF1 were used as the immunogen for the IKAROS / IKZF1 antibody.
After reconstitution, the IKAROS / IKZF1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
IKZF1 Antibody, Ikaros Antibody, Ikaros Family Zinc Finger 1 Antibody, Lymphoid Development Transcription Factor Antibody, Hematopoietic Transcription Factor Antibody, Zinc Finger Transcription Factor Antibody, Immune Cell Development Regulator Antibody, Ikaros Family Protein Antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.