• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> IKZF1 Antibody / Lymphoid Development Transcription Factor Antibody

IKZF1 Antibody / Lymphoid Development Transcription Factor Antibody (R32214)

  Catalog No Formulation Size Price (USD)  
Image R32214 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
IKZF1 Antibody MCF-7 IF. Immunofluorescent staining of MCF-7 cells using IKZF1 Antibody / Ikaros Family Zinc Finger 1 Antibody demonstrates strong green fluorescence within the cellular compartment, consistent with expression of IKZF1 (Ikaros), a zinc finger transcription factor that regulates hematopoietic differentiation, lymphoid development, and gene expression programs involved in cellular fate determination. Positive immunoreactivity confirms detection of endogenous IKZF1 and supports the utility of this antibody for immunofluorescence applications. Nuclei are counterstained with DAPI (blue). Enzymatic antigen retrieval was performed for 15 min prior to staining, followed by incubation with IKZF1 antibody (5 ug/ml) overnight at 4°C and DyLight 488-conjugated secondary antibody detection.
IKZF1 Antibody Human Tonsil IHC. Immunohistochemical staining of FFPE human tonsil tissue using IKZF1 Antibody / Lymphoid Development Transcription Factor Antibody demonstrates prominent nuclear HRP-DAB brown staining within subsets of lymphoid cells. The staining pattern is consistent with expression of IKZF1 (Ikaros), a master regulator of lymphoid lineage commitment that controls gene expression programs required for lymphocyte differentiation, immune cell maturation, and hematopoietic development. Strong nuclear localization is expected for this DNA-binding transcription factor and highlights its central role in regulating the formation and maintenance of lymphoid cell populations. These findings support the utility of this antibody for immunohistochemical detection of endogenous IKZF1 in lymphoid tissues. HIER: boil paraffin sections in pH 6, 10mM citrate buffer for 20 min and allow to cool prior to staining.
IKZF1 Antibody Mouse Spleen IHC. Immunohistochemical staining of FFPE mouse spleen tissue using IKZF1 Antibody / Lymphoid Development Transcription Factor Antibody demonstrates distinct nuclear HRP-DAB brown staining within scattered lymphoid cell populations. The staining pattern is consistent with expression of IKZF1 (Ikaros), a master regulator of lymphoid development that controls transcriptional programs required for lymphocyte differentiation, immune cell maturation, and hematopoietic lineage commitment. Predominantly nuclear immunoreactivity is expected for this DNA-binding transcription factor and reflects its central role in regulating gene expression during immune system development and maintenance. These findings support the utility of this antibody for immunohistochemical detection of endogenous IKZF1 in lymphoid tissues. HIER: boil paraffin sections in pH 6, 10mM citrate buffer for 20 min and allow to cool prior to staining.
IKZF1 Antibody Rat Spleen IHC. Immunohistochemical staining of FFPE rat spleen tissue using IKZF1 Antibody / Lymphoid Development Transcription Factor Antibody demonstrates distinct nuclear HRP-DAB brown staining within lymphoid cell populations. The staining pattern is consistent with expression of IKZF1 (Ikaros), a master regulator of lymphoid lineage commitment that directs transcriptional programs required for lymphocyte differentiation, immune cell maturation, and hematopoietic development. Positive nuclear immunoreactivity is expected for this DNA-binding transcription factor and highlights its essential role in regulating gene expression networks that govern normal lymphoid cell function and immune system formation. The observed staining supports the utility of this antibody for immunohistochemical detection of endogenous IKZF1 in lymphoid tissues. HIER: boil paraffin sections in pH 6, 10mM citrate buffer for 20 min and allow to cool prior to staining.
IKZF1 Antibody Daudi WB. Western blot analysis of human Daudi cell lysate using IKZF1 Antibody / Ikaros Family Zinc Finger 1 Antibody demonstrates multiple immunoreactive bands between approximately 50–70 kDa, consistent with the known molecular weight range of IKZF1 (Ikaros). IKZF1 undergoes extensive alternative splicing, generating multiple protein isoforms that differ in DNA-binding and regulatory domains, resulting in the characteristic multi-band pattern frequently observed in lymphoid cells. As a master regulator of hematopoietic and lymphoid differentiation, IKZF1 plays essential roles in immune cell development, transcriptional regulation, and chromatin remodeling. Detection of multiple endogenous IKZF1 isoforms in Daudi cells supports the specificity of this antibody for western blot applications. Predicted molecular weight: ~50–70 kDa. Observed molecular weights: ~50–70 kDa.
IKZF1 Antibody U937 Flow Cytometry. Flow cytometric analysis of human U937 cells stained with IKZF1 Antibody / Ikaros Family Zinc Finger 1 Antibody demonstrates a pronounced rightward shift of the antibody-stained population (blue) relative to both the isotype control (green) and unstained cells (red). The observed fluorescence profile is consistent with expression of IKZF1 (Ikaros), a zinc finger transcription factor that functions as a master regulator of hematopoietic differentiation, lymphoid development, and transcriptional control of immune-related gene expression. The clear separation between the IKZF1-positive and control populations supports specific detection of endogenous IKZF1 by intracellular flow cytometry. Cells were fixed with 4% paraformaldehyde, permeabilized, and stained with IKZF1 antibody (1 ug/10^6 cells), followed by DyLight 488-conjugated secondary antibody detection. Red = unstained cells, Green = isotype control, Blue = IKZF1 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q13422
Localization Nuclear
Applications Western Blot : 0.1-0.5ug/ml
Immunohistochemistry (FFPE) : 0.5-1ug/ml
Immunofluorescence : 5ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This IKZF1 Antibody / Lymphoid Development Transcription Factor Antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

IKZF1 Antibody / Lymphoid Development Transcription Factor Antibody recognizes IKZF1, also known as Ikaros, a zinc finger DNA-binding transcription factor that serves as a master regulator of hematopoietic and lymphoid development. IKZF1 belongs to the Ikaros family of transcription factors and controls the expression of genes required for lineage commitment, cellular differentiation, and maturation of immune cell populations. Through its ability to regulate chromatin organization and transcriptional activity, IKZF1 plays a central role in establishing and maintaining normal hematopoietic function. Because of its importance in immune system development, IKZF1 has become one of the most widely studied transcription factors in hematology and immunology research.

IKZF1 Antibody is widely used for investigating lymphocyte development and immune cell differentiation. Expression of IKZF1 is closely associated with hematopoietic stem cells, lymphoid progenitors, and developing B- and T-cell populations. The protein functions as both a transcriptional activator and repressor, coordinating complex gene expression programs that determine immune cell identity and function. Loss or disruption of IKZF1 activity can impair normal lymphoid differentiation and alter immune system development, highlighting its essential biological role.

IKZF1 Antibody is particularly valuable for studies of hematopoiesis and stem cell biology. During blood cell development, IKZF1 regulates the balance between self-renewal, lineage commitment, and cellular maturation. By controlling developmental gene networks, IKZF1 helps guide progenitor cells toward specialized immune cell fates while maintaining appropriate transcriptional programs throughout differentiation. These functions make IKZF1 an important marker for investigations of developmental biology and hematopoietic regulation.

IKZF1 Antibody also supports research involving chromatin remodeling and transcriptional control. Ikaros proteins recruit chromatin-modifying complexes and influence higher-order chromatin structure, allowing them to coordinate large gene expression programs that affect proliferation, differentiation, and cellular function. Through these mechanisms, IKZF1 integrates developmental signals with transcriptional regulation and contributes to maintenance of immune homeostasis.

IKZF1 Antibody has significant relevance in leukemia and lymphoma research. Genetic alterations, deletions, mutations, or abnormal expression of IKZF1 have been associated with several hematologic malignancies, particularly acute lymphoblastic leukemia (ALL). Changes in IKZF1 activity can disrupt normal differentiation pathways and contribute to malignant transformation. Consequently, IKZF1 is frequently evaluated as a biomarker of lymphoid lineage development and as a target for studies of leukemia pathogenesis and disease progression.

IKZF1 Antibody is additionally useful for investigations of immune regulation, hematologic disease, and developmental signaling pathways. Because IKZF1 occupies a central position in the genetic networks that control lymphocyte development and immune system formation, it provides valuable insight into both normal hematopoiesis and disease-associated alterations in transcriptional regulation.

IKZF1 Antibody supports research involving lymphocyte differentiation, hematopoietic stem cells, immune system development, chromatin remodeling, transcriptional regulation, leukemia, lymphoma, and developmental biology. As a master regulator of lymphoid lineage commitment, IKZF1 remains an essential target for understanding immune cell development and hematologic disease mechanisms.

Researchers studying lymphocyte development, hematopoiesis, immune cell differentiation, and transcriptional regulation of the immune system may also be interested in our comprehensive collection of Immunology Antibodies.

Application Notes

Optimal dilution of the IKZF1 Antibody / Lymphoid Development Transcription Factor Antibody should be determined by the researcher.

Immunogen

Amino acids LKEEHRAYDLLRAASENSQDALRVVSTSGEQM of human IKZF1 were used as the immunogen for the IKAROS / IKZF1 antibody.

Storage

After reconstitution, the IKAROS / IKZF1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Alternate Names

IKZF1 Antibody, Ikaros Antibody, Ikaros Family Zinc Finger 1 Antibody, Lymphoid Development Transcription Factor Antibody, Hematopoietic Transcription Factor Antibody, Zinc Finger Transcription Factor Antibody, Immune Cell Development Regulator Antibody, Ikaros Family Protein Antibody

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.