• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> IFNGR1 Antibody / CD119

IFNGR1 Antibody / CD119 (R32686)

  Catalog No Formulation Size Price (USD)  
Image R32686 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of human 1) HepG2 and 2) SKOV3 cell lysate with IFNGR1 antibody at 0.5ug/ml. Predicted molecular weight: ~54 kDa (unmodified), 80-100 kDa (glycosylated).
Flow cytometry testing of human A549 cells with IFNGR1 antibody at 1ug/10^6 cells (cells blocked with goat sera); Red=cells alone, Green=isotype control, Blue=IFNGR1 antibody.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P15260
Applications Western Blot : 0.5-1ug/ml
Flow Cytometry : 1-3ug/10^6 cells
Limitations This IFNGR1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P, IF, FACS, ELISA (peptide)
    Reactivity : Human
  • Applications : WB, FACS
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Mouse, Rat

Description

Interferon gamma receptor 1 (IFNGR1), also known as CD119 (Cluster of Differentiation 119), is a protein that in humans is encoded by the IFNGR1 gene. This gene encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.

Application Notes

Optimal dilution of the IFNGR1 antibody should be determined by the researcher.

Immunogen

Amino acids 443-484 (QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED) from the human protein were used as the immunogen for the IFNGR1 antibody.

Storage

After reconstitution, the IFNGR1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.