• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> ICA1 Antibody / Islet cell autoantigen 1

ICA1 Antibody / Islet cell autoantigen 1 (R32190)

  Catalog No Formulation Size Price (USD)  
Image R32190 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of 1) human SH-SY5Y, 2) human RT4, 3) human MCF7, 4) human K562, 5) rat pancreas, 6) rat brain, 7) mouse pancreas and 8) mouse brain tissue lysate with ICA1 antibody. Predicted molecular weight ~55 kDa but can also be observed at 64-69 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q05084
Applications Western Blot : 0.5-1ug/ml
Limitations This ICA1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. What's more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene.

Application Notes

Optimal dilution of the ICA1 antibody should be determined by the researcher.

Immunogen

Amino acids EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK of human ICA1 were used as the immunogen for the ICA1 antibody.

Storage

After reconstitution, the ICA1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.