- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
IBA1 antibody recognizes Ionized calcium-binding adapter molecule 1 (AIF-1), a small cytoplasmic protein predominantly expressed in cells of the myeloid lineage, most notably microglia in the central nervous system and macrophages in peripheral tissues. IBA1 is widely used as a cellular marker for microglial identification due to its consistent expression across resting and activated microglial states and its strong association with innate immune cell function and immune surveillance activity within neural tissue.
Ionized calcium-binding adapter molecule 1 is encoded by the AIF1 gene and produces a highly conserved protein containing EF-hand calcium-binding motifs. These structural elements enable calcium-dependent protein interactions that link intracellular signaling events to cytoskeletal remodeling. Through these interactions, IBA1 associates with actin-regulatory proteins and contributes to changes in cell shape, membrane ruffling, and cytoplasmic extension, all of which are critical for immune cell motility and phagocytic behavior.
Functionally, IBA1 plays an important role in regulating actin dynamics during microglial activation. Microglia rely on rapid cytoskeletal rearrangement to survey their microenvironment, migrate toward sites of injury or infection, and engulf cellular debris. IBA1 expression supports these processes by facilitating actin cross-linking and stabilizing membrane protrusions. These functions are essential for both homeostatic immune surveillance and reactive immune responses in the central nervous system.
Under physiological conditions, IBA1 is constitutively expressed in resting microglia, where it supports basal motility and continuous environmental sensing. Upon immune activation triggered by neuronal damage, infection, ischemia, or neurodegenerative processes, IBA1 expression is frequently upregulated. This increase correlates with well-characterized morphological changes, including retraction of fine cellular processes, enlargement of the cell body, and increased phagocytic capacity. These changes reflect a shift from a surveillant to an activated immune phenotype.
IBA1 is primarily localized to the cytoplasm, with enrichment near the plasma membrane and within actin-rich regions of the cell. In tissue sections, IBA1 immunoreactivity typically highlights microglial cell bodies and branching processes, providing clear visualization of microglial distribution and morphology. This staining pattern makes IBA1 antibody-based detection particularly useful for assessing microglial density, activation state, and spatial organization across different brain regions and experimental conditions.
Outside the central nervous system, IBA1 is expressed by macrophages and related myeloid cells in tissues such as spleen, lymph nodes, liver, and sites of inflammation. In these peripheral contexts, IBA1 contributes to immune cell migration, phagocytosis, and inflammatory signaling. Detection of IBA1-positive macrophages is commonly used to evaluate immune cell infiltration, tissue remodeling, and inflammatory status in both normal and pathological samples.
Altered microglial activation marked by changes in IBA1 expression has been implicated in a wide range of pathological conditions, including neurodegenerative diseases, traumatic brain injury, ischemic stroke, multiple sclerosis, and tumor-associated neuroinflammation. Because IBA1 expression reflects both microglial presence and activation-associated morphological changes, it is frequently used to assess immune involvement and disease progression in experimental models and translational research settings. NSJ Bioreagents provides reagents intended for research use to support studies of IBA1 expression in microglia and macrophage populations.
An IBA1 antibody is suitable for research applications requiring detection and visualization of microglia or macrophage populations, including studies focused on neuroinflammation, innate immune responses, immune cell dynamics, and tissue-resident myeloid cell biology.
Optimal dilution of the IBA1 antibody should be determined by the researcher.
Amino acids 99-133 (ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK) from the human protein were used as the immunogen for the IBA1 antibody.
After reconstitution, the IBA1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.