• Tel: 858.663.9055
  • Email: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> HtrA3 Antibody

HtrA3 Antibody (R32751)

  Catalog No Formulation Size Price (USD)  
R32751 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 329
Western blot testing of human 1) PANC1 and 2) HepG2 cell lysate with HtrA3 antibody at 0.5ug/ml. Predicted molecular weight ~49 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P83110
Applications Western Blot : 0.5-1ug/ml
Limitations This HtrA3 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Human HtrA3 protease, which induces mitochondria-mediated apoptosis, can be a tumor suppressor and a potential therapeutic target in the treatment of cancer. It may also have a role in ovarian development, granulosa cell differentiation and luteinization. The long isoform, HTRA3L, contains 453 amino acids and has a predicted molecular mass of 49 kD. It contains an N-terminal signal peptide, followed by an insulin/IGF (see 147440)-binding domain, a Kazal-type S protease inhibitor domain, a trypsin protease domain, and a PDZ domain. The short isoform, HTRA3S, contains 357 amino acids and has a predicted molecular mass of 38 kD.

Application Notes

Optimal dilution of the HtrA3 antibody should be determined by the researcher.

Immunogen

Amino acids 330-362 (FAIPSDRITRFLTEFQDKQIKDWKKRFIGIRMR) from the human protein were used as the immunogen for the HtrA3 antibody.

Storage

After reconstitution, the HtrA3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code:


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.