• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> HSPA2 Antibody

HSPA2 Antibody [clone 4A4] (RQ4498)

  Catalog No Formulation Size Price (USD)  
Image RQ4498 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of human 1) HeLa, 2) MBA-MD-231, 3) COLO-320, 4) PANC-1, 5) HT180, 6) MBA-MD-453 and 7) HepG2 lysate with HSPA2 antibody at 0.5ug/ml. Expected molecular weight ~70 kDa.
IHC testing of FFPE human lung cancer with HSPA2 antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Availability 1-3 business days
Species Reactivity Human
Format Purified
Host Mouse
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG1
Clone Name 4A4
Purity Protein G affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P54652
Localization Cytoplasm
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Limitations This HSPA2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC-P, FACS, IF/ICC
    Reactivity : Human, Mouse, Rat

Description

HSPA2 (heat shock 70kDa protein 2) is also known as HEAT-SHOCK PROTEIN, 70-KD, 2, HSP70-2, HEAT-SHOCK PROTEIN, 70-KD, 3 or HSP70-3. Analysis of the sequence indicated that HSPA2 is the human homolog of the murine Hsp70-2 gene, with 91.7% identity in the nucleotide coding sequence and 98.2% in the corresponding amino acid sequence. HSPA2 has less amino acid homology to the other members of the human HSP70 gene family. HSPA2 is constitutively expressed in most tissues, with very high levels in testis and skeletal muscle. The HSPA2 gene is located on chromosome 14q22-q24. Immunohistochemical analysis detected weak expression of HSPA2 in spermatocytes and stronger expression in spermatids and in the tail of mature sperm. HSPA2 may be critical to sperm maturation through its role as a protein chaperone.

Application Notes

Optimal dilution of the HSPA2 antibody should be determined by the researcher.

Immunogen

Amino acids KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK was used as the immunogen for the HSPA2 antibody.

Storage

After reconstitution, the HSPA2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.