• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> HSP90AA1 Antibody / HSP90 alpha

HSP90AA1 Antibody / HSP90 alpha [clone 6B5] (RQ6535)

  Catalog No Formulation Size Price (USD)  
Image RQ6535 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Immunofluorescent staining of FFPE human SiHa cells with HSP90AA1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC staining of FFPE human colon cancer tissue with HSP90AA1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human cervical cancer tissue with HSP90AA1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human lung cancer tissue with HSP90AA1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human testis cancer tissue with HSP90AA1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of 1) human HeLa, 2) human HEK293, 3) monkey COS-7, 4) human HepG2, 5) human A549, 6) rat PC-3, 7) rat RH35 and 8) mouse HEPA1-6 cell lysate with HSP90AA1 antibody. Expected molecular weight: 86~90 kDa.
Flow cytometry testing of human A549 cells with HSP90AA1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HSP90AA1 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat, Monkey
Format Antigen affinity purified
Host Mouse
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG2b
Clone Name 6B5
Purity Affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P07900
Localization Cell membrane, cytoplasmic, nuclear
Applications Western Blot : 1-2ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Immunofluorescence : 5ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This HSP90AA1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Heat shock protein HSP 90-alpha is a protein that in humans is encoded by the HSP90AA1 gene. This gene encodes the human stress-inducible 90-kDa heat shock protein alpha (Hsp90A). Complemented by the constitutively expressed paralog Hsp90B which shares over 85% amino acid sequence identity, Hsp90A expression is initiated when a cell experiences proteotoxic stress. Once expressed Hsp90A dimers operate as molecular chaperones that bind and fold other proteins into their functional 3-dimensional structures. This molecular chaperoning ability of Hsp90A is driven by a cycle of structural rearrangements fueled by ATP hydrolysis. Current research on Hsp90A focuses in its role as a drug target due to its interaction with a large number of tumor promoting proteins and its role in cellular stress adaptation.

Application Notes

Optimal dilution of the HSP90AA1 antibody should be determined by the researcher.

Immunogen

Amino acids 454-488 (QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQ) from the human protein were used as the immunogen for the HSP90AA1 antibody.

Storage

After reconstitution, the HSP90AA1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.