- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
HSP90AA1 Antibody / Molecular Chaperone Antibody detects HSP90AA1, also known as heat shock protein 90 alpha (HSP90 alpha), a highly conserved ATP-dependent molecular chaperone that plays a central role in protein folding, stabilization, trafficking, and quality control. HSP90AA1 is one of the most abundant intracellular chaperones in eukaryotic cells and is required for the proper maturation and function of a diverse range of client proteins. Through its extensive interaction network, HSP90AA1 regulates numerous cellular pathways involved in growth, survival, differentiation, and stress adaptation, making it one of the most extensively studied proteins in cell biology and biomedical research.
As a molecular chaperone, HSP90AA1 assists newly synthesized proteins in achieving and maintaining their proper three-dimensional structure. The protein functions in concert with co-chaperones and other members of the cellular chaperone machinery to prevent protein misfolding, aggregation, and degradation. HSP90AA1 interacts with hundreds of client proteins, including kinases, transcription factors, signaling intermediates, and hormone receptors. Because many of these clients serve as critical regulators of cellular function, HSP90AA1 occupies a central position within multiple signaling and regulatory networks.
HSP90AA1 is also a major component of the cellular stress response system. Expression and activity of HSP90 proteins can be influenced by heat shock, oxidative stress, inflammation, toxicant exposure, metabolic challenges, and other physiological stresses. By stabilizing damaged or partially unfolded proteins, HSP90AA1 helps maintain cellular homeostasis and supports recovery from adverse environmental conditions. These functions have established HSP90AA1 as an important marker for studies of proteostasis, cellular resilience, and stress-response pathways.
Beyond its role in protein quality control, HSP90AA1 participates in the regulation of signal transduction, cell cycle progression, apoptosis, and developmental processes. Numerous signaling pathways rely on HSP90AA1-mediated stabilization of key regulatory proteins, and disruption of HSP90 function can significantly alter cellular behavior. Consequently, HSP90AA1 has become a major focus of research involving cancer biology, stem cell regulation, developmental biology, neurobiology, immunology, and cardiovascular physiology.
Aberrant HSP90AA1 expression or activity has been associated with a wide variety of disease processes. The protein is frequently studied in oncology due to its ability to stabilize multiple oncogenic client proteins simultaneously, and HSP90 inhibition has emerged as an important therapeutic strategy in cancer research. HSP90AA1 has also been implicated in neurodegenerative disorders, inflammatory diseases, and conditions characterized by altered protein homeostasis. Its broad biological significance continues to drive interest in understanding how molecular chaperones contribute to health and disease.
HSP90AA1 Antibody / Molecular Chaperone Antibody is useful for researchers studying protein folding, molecular chaperones, proteostasis, cellular stress responses, signal transduction, cancer biology, developmental pathways, and cell survival mechanisms. Validation may include applications such as immunohistochemistry, western blotting, immunofluorescence, flow cytometry, ELISA, and protein expression analysis when supported by experimental data. As a master regulator of protein stability and cellular homeostasis, HSP90AA1 remains an essential target for investigating the molecular mechanisms that govern normal cellular function and disease-associated biological pathways.
Explore our Cell Biology Antibodies page for additional reagents involved in protein folding, cellular stress responses, signal transduction, and maintenance of cellular homeostasis.
Optimal dilution of the HSP90AA1 Antibody / Molecular Chaperone Antibody should be determined by the researcher.
Amino acids 454-488 (QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQ) from the human protein were used as the immunogen for the HSP90AA1 antibody.
After reconstitution, the HSP90AA1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
HSP90AA1 Antibody, HSP90 Alpha Antibody, Heat Shock Protein 90 Alpha Antibody, Heat Shock Protein 90 Alpha Family Class A Member 1 Antibody, Molecular Chaperone HSP90 Antibody, Stress Response Protein Antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.